Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1426 [new locus tag: SACOL_RS07265 ]
- pan locus tag?: SAUPAN003803000
- symbol: SACOL1426
- pan gene symbol?: cvfB
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1426 [new locus tag: SACOL_RS07265 ]
- symbol: SACOL1426
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1437091..1437993
- length: 903
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236375 NCBI
- RefSeq: YP_186278 NCBI
- BioCyc: see SACOL_RS07265
- MicrobesOnline: 912884 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGGCATTAGACAAAGATATAGTAGGTTCTATAGAATTCCTTGAAGTAGTAGGGTTACAA
GGTTCAACTTACCTTTTAAAAGGACCAAACGGTGAAAACGTAAAGTTAAACCAATCAGAA
ATGAACGATGATGATGAATTAGAAGTAGGTGAAGAATATAGTTTCTTCATTTATCCAAAC
CGTTCAGGTGAATTATTTGCAACTCAAAATATGCCTGATATTACGAAAGATAAATATGAC
TTTGCTAAAGTACTTAAAACGGATCGCGATGGGGCACGTATAGATGTTGGATTACCCCGT
GAAGTGTTAGTACCATGGGAAGATTTACCAAAAGTGAAATCACTATGGCCACAACCTGGT
GATTATTTGCTAGTTACATTACGAATTGACCGTGAGAATCATATGTATGGACGTTTAGCG
AGTGAATCTGTTGTAGAAAATATGTTTACACCTGTACACGACGATAATTTAAAAAACGAA
GTCATTGAAGCCAAACCTTACCGCGTATTACGAATTGGTAGCTTTTTATTAAGCGAATCA
GGTTACAAAATTTTCGTACATGAATCAGAACGTAAAGCTGAACCAAGATTAGGTGAATCT
GTTCAAGTTAGAATTATCGGGCATAATGATAAAGGTGAGTTAAATGGTTCATTTTTACCA
CTTGCACATGAACGTTTAGACGATGACGGCCAAGTCATCTTTGATTTACTAGTTGAATAT
GATGGTGAATTACCATTCTGGGACAAATCAAGCCCTGAAGCGATTAAAGAAGTATTCAAT
ATGAGTAAAGGTTCATTCAAACGTGCAATCGGTCACTTATATAAACAGAAGATTATTAAT
ATAGAAACAGGTAAAATCGCTTTAACTAAAAAAGGTTGGAGTCGAATGGACTCAAAAGAA
TAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
903
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1426 [new locus tag: SACOL_RS07265 ]
- symbol: SACOL1426
- description: hypothetical protein
- length: 300
- theoretical pI: 4.76461
- theoretical MW: 34198.5
- GRAVY: -0.494667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- S1 RNA binding domain
- PFAM: HTH (CL0123) CvfB_WH; CvfB-like winged helix domain (PF17783; HMM-score: 78.8)and 4 moreOB (CL0021) CvfB_2nd; Virulence regulatory factor CvfB, second domain (PF21543; HMM-score: 62.2)CvfB_1st; CvfB first S1-like domain (PF21191; HMM-score: 52)S1_2; S1 domain (PF13509; HMM-score: 39.3)S1; S1 RNA binding domain (PF00575; HMM-score: 17.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9778
- Cytoplasmic Membrane Score: 0.0167
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0053
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005867
- TAT(Tat/SPI): 0.002812
- LIPO(Sec/SPII): 0.002347
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPNRSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPGDYLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSESGYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEYDGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKIALTKKGWSRMDSKE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 650 [4]
- interaction partners:
SACOL1247 (acpP) acyl carrier protein [5] (data from MRSA252) SACOL2218 (adk) adenylate kinase [5] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [5] (data from MRSA252) SACOL0663 (argS) arginyl-tRNA synthetase [5] (data from MRSA252) SACOL2095 (atpD) F0F1 ATP synthase subunit beta [5] (data from MRSA252) SACOL1215 (carB) carbamoyl phosphate synthase large subunit [5] (data from MRSA252) SACOL1786 (ccpA) catabolite control protein A [5] (data from MRSA252) SACOL1518 (cmk) cytidylate kinase [5] (data from MRSA252) SACOL0557 (cysK) cysteine synthase [5] (data from MRSA252) SACOL2074 (ddl) D-alanyl-alanine synthetase A [5] (data from MRSA252) SACOL1244 (fabD) malonyl CoA-ACP transacylase [5] (data from MRSA252) SACOL0987 (fabH) 3-oxoacyl-ACP synthase [5] (data from MRSA252) SACOL1016 (fabI) enoyl-ACP reductase [5] (data from MRSA252) SACOL2091 (fabZ) (3R)-hydroxymyristoyl-ACP dehydratase [5] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [5] (data from MRSA252) SACOL1278 (frr) ribosome recycling factor [5] (data from MRSA252) SACOL1198 (ftsA) cell division protein FtsA [5] (data from MRSA252) SACOL1199 (ftsZ) cell division protein FtsZ [5] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [5] (data from MRSA252) SACOL1961 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [5] (data from MRSA252) SACOL1960 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [5] (data from MRSA252) SACOL1595 (gcvT) glycine cleavage system aminomethyltransferase T [5] (data from MRSA252) SACOL2145 (glmS) glucosamine--fructose-6-phosphate aminotransferase [5] (data from MRSA252) SACOL2017 (groES) co-chaperonin GroES [5] (data from MRSA252) SACOL0554 (hpt) hypoxanthine phosphoribosyltransferase [5] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [5] (data from MRSA252) SACOL1206 (ileS) isoleucyl-tRNA synthetase [5] (data from MRSA252) SACOL0600 (ilvE) branched-chain amino acid aminotransferase [5] (data from MRSA252) SACOL1288 (infB) translation initiation factor IF-2 [5] (data from MRSA252) SACOL1727 (infC) translation initiation factor IF-3 [5] (data from MRSA252) SACOL2584 (isaA) immunodominant antigen A [5] (data from MRSA252) SACOL0236 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [5] (data from MRSA252) SACOL1368 (kataA) catalase [5] (data from MRSA252) SACOL0222 (ldh1) L-lactate dehydrogenase [5] (data from MRSA252) SACOL1808 (leuS) leucyl-tRNA synthetase [5] (data from MRSA252) SACOL1054 (menB) naphthoate synthase [5] (data from MRSA252) SACOL2149 (mtlD) mannitol-1-phosphate 5-dehydrogenase [5] (data from MRSA252) SACOL2116 (murAB) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [5] (data from MRSA252) SACOL1509 (ndk) nucleoside diphosphate kinase [5] (data from MRSA252) SACOL1285 (nusA) transcription elongation factor NusA [5] (data from MRSA252) SACOL2615 (panB) 3-methyl-2-oxobutanoate hydroxymethyltransferase [5] (data from MRSA252) SACOL1389 (parE) DNA topoisomerase IV subunit B [5] (data from MRSA252) SACOL1838 (pckA) phosphoenolpyruvate carboxykinase [5] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [5] (data from MRSA252) SACOL1005 (pepF) oligoendopeptidase F [5] (data from MRSA252) SACOL1746 (pfkA) 6-phosphofructokinase [5] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [5] (data from MRSA252) SACOL1293 (pnp) polynucleotide phosphorylase/polyadenylase [5] (data from MRSA252) SACOL1282 (proS) prolyl-tRNA synthetase [5] (data from MRSA252) SACOL0544 (prsA) ribose-phosphate pyrophosphokinase [5] (data from MRSA252) SACOL1092 (ptsI) phosphoenolpyruvate-protein phosphotransferase [5] (data from MRSA252) SACOL0539 (purR) pur operon repressor [5] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [5] (data from MRSA252) SACOL1213 (pyrC) dihydroorotase [5] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [5] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [5] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [5] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [5] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [5] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [5] (data from MRSA252) SACOL0015 (rplI) 50S ribosomal protein L9 [5] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [5] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [5] (data from MRSA252) SACOL2207 (rplM) 50S ribosomal protein L13 [5] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [5] (data from MRSA252) SACOL2223 (rplR) 50S ribosomal protein L18 [5] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [5] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [5] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [5] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [5] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [5] (data from MRSA252) SACOL2228 (rplX) 50S ribosomal protein L24 [5] (data from MRSA252) SACOL1700 (rpmA) 50S ribosomal protein L27 [5] (data from MRSA252) SACOL1238 (rpmB) 50S ribosomal protein L28 [5] (data from MRSA252) SACOL2231 (rpmC) 50S ribosomal protein L29 [5] (data from MRSA252) SACOL2112 (rpmE2) 50S ribosomal protein L31 [5] (data from MRSA252) SACOL1726 (rpmI) 50S ribosomal protein L35 [5] (data from MRSA252) SACOL2213 (rpoA) DNA-directed RNA polymerase subunit alpha [5] (data from MRSA252) SACOL0589 (rpoC) DNA-directed RNA polymerase subunit beta' [5] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [5] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [5] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [5] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [5] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [5] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [5] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [5] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [5] (data from MRSA252) SACOL2215 (rpsM) 30S ribosomal protein S13 [5] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [5] (data from MRSA252) SACOL0439 (rpsR) 30S ribosomal protein S18 [5] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [5] (data from MRSA252) SACOL1632 (rpsU) 30S ribosomal protein S21 [5] (data from MRSA252) SACOL2056 (rsbV) anti-anti-sigma factor RsbV [5] (data from MRSA252) SACOL1610 (sodA2) superoxide dismutase [5] (data from MRSA252) SACOL0541 (spoVG) regulatory protein SpoVG [5] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [5] (data from MRSA252) SACOL1831 (tal) translaldolase [5] (data from MRSA252) SACOL1729 (thrS) threonyl-tRNA synthetase [5] (data from MRSA252) SACOL1377 (tkt) transketolase [5] (data from MRSA252) SACOL1276 (tsf) elongation factor Ts [5] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [5] (data from MRSA252) SACOL2104 (upp) uracil phosphoribosyltransferase [5] (data from MRSA252) SACOL1202 (ylmF) hypothetical protein [5] (data from MRSA252) SACOL0220 flavohemoprotein [5] (data from MRSA252) SACOL0303 5'-nucleotidase [5] (data from MRSA252) SACOL0426 acetyl-CoA acetyltransferase [5] (data from MRSA252) SACOL0521 hypothetical protein [5] (data from MRSA252) SACOL0552 hypothetical protein [5] (data from MRSA252) SACOL0596 2-amino-3-ketobutyrate coenzyme A ligase [5] (data from MRSA252) SACOL0599 hypothetical protein [5] (data from MRSA252) SACOL0688 ABC transporter substrate-binding protein [5] (data from MRSA252) SACOL0707 dihydroxyacetone kinase subunit DhaK [5] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [5] (data from MRSA252) SACOL0742 hypothetical protein [5] (data from MRSA252) SACOL0931 HAD superfamily hydrolase [5] (data from MRSA252) SACOL1020 hypothetical protein [5] (data from MRSA252) SACOL1098 hypothetical protein [5] (data from MRSA252) SACOL1240 DAK2 domain-containing protein [5] (data from MRSA252) SACOL1588 proline dipeptidase [5] (data from MRSA252) SACOL1593 glycine dehydrogenase subunit 2 [5] (data from MRSA252) SACOL1615 DEAD/DEAH box helicase [5] (data from MRSA252) SACOL1651 hypothetical protein [5] (data from MRSA252) SACOL1670 hypothetical protein [5] (data from MRSA252) SACOL1753 universal stress protein [5] (data from MRSA252) SACOL1759 universal stress protein [5] (data from MRSA252) SACOL1777 serine protease HtrA [5] (data from MRSA252) SACOL1787 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase [5] (data from MRSA252) SACOL1788 hypothetical protein [5] (data from MRSA252) SACOL1792 hypothetical protein [5] (data from MRSA252) SACOL1794 thioredoxin [5] (data from MRSA252) SACOL1801 dipeptidase PepV [5] (data from MRSA252) SACOL1992 hypothetical protein [5] (data from MRSA252) SACOL2296 glycerate dehydrogenase [5] (data from MRSA252) SACOL2569 1-pyrroline-5-carboxylate dehydrogenase [5] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 12.11 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 5.000 5.001 5.002 5.003 5.004 5.005 5.006 5.007 5.008 5.009 5.010 5.011 5.012 5.013 5.014 5.015 5.016 5.017 5.018 5.019 5.020 5.021 5.022 5.023 5.024 5.025 5.026 5.027 5.028 5.029 5.030 5.031 5.032 5.033 5.034 5.035 5.036 5.037 5.038 5.039 5.040 5.041 5.042 5.043 5.044 5.045 5.046 5.047 5.048 5.049 5.050 5.051 5.052 5.053 5.054 5.055 5.056 5.057 5.058 5.059 5.060 5.061 5.062 5.063 5.064 5.065 5.066 5.067 5.068 5.069 5.070 5.071 5.072 5.073 5.074 5.075 5.076 5.077 5.078 5.079 5.080 5.081 5.082 5.083 5.084 5.085 5.086 5.087 5.088 5.089 5.090 5.091 5.092 5.093 5.094 5.095 5.096 5.097 5.098 5.099 5.100 5.101 5.102 5.103 5.104 5.105 5.106 5.107 5.108 5.109 5.110 5.111 5.112 5.113 5.114 5.115 5.116 5.117 5.118 5.119 5.120 5.121 5.122 5.123 5.124 5.125 5.126 5.127 5.128 5.129 5.130 5.131 5.132 5.133 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)