⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1801 [new locus tag: SACOL_RS09230 ]
- pan locus tag?: SAUPAN004429000
- symbol: SACOL1801
- pan gene symbol?: —
- synonym:
- product: dipeptidase PepV
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1801 [new locus tag: SACOL_RS09230 ]
- symbol: SACOL1801
- product: dipeptidase PepV
- replicon: chromosome
- strand: -
- coordinates: 1848684..1850093
- length: 1410
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236055 NCBI
- RefSeq: YP_186634 NCBI
- BioCyc: see SACOL_RS09230
- MicrobesOnline: 913245 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381ATGTGGAAAGAAAAAGTTCAACAATACGAAGATCAAATCATTAATGACTTAAAAGGATTA
TTAGCAATTGAAAGTGTGAGAGATGATGCAAAAGCATCAGAAGACGCACCAGTTGGTCCA
GGTCCTCGTAAGGCATTAGACTACATGTATGAAATTGCACATAGAGATGGATTTACAACA
CATGATGTGGATCATATTGCAGGAAGAATTGAGGCAGGTAAAGGAAATGACGTATTAGGT
ATCTTATGTCATGTTGACGTTGTTCCTGCTGGTGATGGATGGGATAGTAATCCGTTCGAG
CCGGTTGTAACAGAAGATGCTATCATAGCTAGAGGTACACTTGATGACAAAGGTCCAACA
ATTGCTGCTTATTATGCAATTAAGATATTAGAAGATATGAATGTGGATTGGAAGAAACGT
ATTCATATGATTATTGGTACGGATGAAGAATCTGATTGGAAATGTACGGATCGCTATTTT
AAAACAGAAGAAATGCCAACATTAGGTTTTGCACCAGATGCAGAATTTCCATGTATTCAT
GGTGAAAAAGGCATTACAACATTTGATTTAGTTCAAAATAAACTTACTGAAGATCAAGAT
GAACCTGATTATGAATTAATAACTTTTAAATCTGGTGAACGTTACAACATGGTACCTGAT
CATGCAGAAGCAAGAGTGCTTGTTAAAGAAAATATGACAGATGTTATTCAAGACTTTGAG
TACTTTTTAGAACAAAATCATTTACAAGGTGATAGTACTGTTGATAGTGGCATTCTAGTT
TTAACAGTTGAAGGTAAAGCGGTTCATGGTATGGATCCATCTATCGGTGTGAATGCGGGT
CTTTACTTACTAAAATTCTTAGCATCATTAAATCTTGATAATAATGCACAAGCGTTTGTA
GCATTTAGTAATCGCTACTTATTTAATTCAGATTTTGGTGAAAAGATGGGAATGAAATTC
CATACAGATGTCATGGGTGACGTGACAACTAACATTGGTGTTATTACATATGATAATGAA
AACGCAGGTCTTTTCGGTATCAACTTACGCTACCCAGAAGGATTTGAATTTGAAAAAGCT
ATGGATCGTTTTGCAAATGAGATTCAACAATATGGCTTTGAAGTGAAATTAGGTAAAGTC
CAACCACCACATTATGTTGATAAAAATGATCCTTTTGTACAAAAGTTAGTTACTGCATAT
AGAAATCAAACAAATGATATGACTGAACCTTATACTATAGGTGGCGGTACTTATGCGAGA
AACTTAGACAAGGGTGTAGCATTTGGCGCAATGTTTAGTGATTCTGAAGATTTAATGCAT
CAGAAAAATGAATATATCACTAAAAAACAGTTATTTAACGCAACTAGTATTTACTTAGAA
GCAATTTATTCATTATGCGTGGAGGAATAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1260
1320
1380
1410
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1801 [new locus tag: SACOL_RS09230 ]
- symbol: SACOL1801
- description: dipeptidase PepV
- length: 469
- theoretical pI: 4.32275
- theoretical MW: 52823.9
- GRAVY: -0.408316
⊟Function[edit | edit source]
- reaction: EC 3.4.13.-? ExPASy
- TIGRFAM: putative dipeptidase (TIGR01887; EC 3.4.13.-; HMM-score: 637.7)and 11 moreProtein fate Degradation of proteins, peptides, and glycopeptides dipeptidase PepV (TIGR01886; EC 3.4.13.-; HMM-score: 459.3)Protein fate Degradation of proteins, peptides, and glycopeptides peptidase, ArgE/DapE family (TIGR01910; EC 3.4.-.-; HMM-score: 105.3)Amino acid biosynthesis Aspartate family succinyl-diaminopimelate desuccinylase (TIGR01246; EC 3.5.1.18; HMM-score: 62.3)putative selenium metabolism hydrolase (TIGR03526; HMM-score: 45)N-acyl-L-amino-acid amidohydrolase (TIGR01880; EC 3.5.1.14; HMM-score: 43.4)Amino acid biosynthesis Glutamate family acetylornithine deacetylase (ArgE) (TIGR01892; EC 3.5.1.16; HMM-score: 40.5)peptidase T-like protein (TIGR01883; HMM-score: 30.6)N-acetyl-ornithine/N-acetyl-lysine deacetylase (TIGR01902; HMM-score: 30.6)Amino acid biosynthesis Aspartate family succinyl-diaminopimelate desuccinylase (TIGR01900; EC 3.5.1.18; HMM-score: 19.6)Xaa-His dipeptidase (TIGR01893; EC 3.4.13.20; HMM-score: 14.9)Protein fate Degradation of proteins, peptides, and glycopeptides amidohydrolase (TIGR01891; HMM-score: 11.8)
- TheSEED :
- Putative Xaa-His dipeptidase
- PFAM: ZnExoPePases (CL0865) Peptidase_M20; Peptidase family M20/M25/M40 (PF01546; HMM-score: 85.2)and 2 moreno clan defined M20_dimer; Peptidase dimerisation domain (PF07687; HMM-score: 36.3)ZnExoPePases (CL0865) Peptidase_M28; Peptidase family M28 (PF04389; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Zn2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9971
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0009
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014046
- TAT(Tat/SPI): 0.001237
- LIPO(Sec/SPII): 0.001764
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTTHDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPTIAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIHGEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFEYFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFVAFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKAMDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYARNLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 2708 [5]
- interaction partners:
SACOL0452 (ahpC) alkyl hydroperoxide reductase subunit C [6] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [6] (data from MRSA252) SACOL1800 (dat) D-alanine aminotransferase [6] (data from MRSA252) SACOL0461 (guaA) GMP synthase [6] (data from MRSA252) SACOL1011 (ppnK) inorganic polyphosphate/ATP-NAD kinase [6] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [6] (data from MRSA252) SACOL1031 5' nucleotidase [6] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 31.52 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.0 6.1 6.2 6.3 6.4 6.5 6.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
H De Lencastre, S W Wu, M G Pinho, A M Ludovice, S Filipe, S Gardete, R Sobral, S Gill, M Chung, A Tomasz
Antibiotic resistance as a stress response: complete sequencing of a large number of chromosomal loci in Staphylococcus aureus strain COL that impact on the expression of resistance to methicillin.
Microb Drug Resist: 1999, 5(3);163-75
[PubMed:10566865] [WorldCat.org] [DOI] (P p)Tavarekere S Girish, Balasubramanian Gopal
Crystal structure of Staphylococcus aureus metallopeptidase (Sapep) reveals large domain motions between the manganese-bound and apo-states.
J Biol Chem: 2010, 285(38);29406-15
[PubMed:20610394] [WorldCat.org] [DOI] (I p)
