From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1199 [new locus tag: SACOL_RS06140 ]
  • pan locus tag?: SAUPAN003456000
  • symbol: ftsZ
  • pan gene symbol?: ftsZ
  • synonym:
  • product: cell division protein FtsZ

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1199 [new locus tag: SACOL_RS06140 ]
  • symbol: ftsZ
  • product: cell division protein FtsZ
  • replicon: chromosome
  • strand: +
  • coordinates: 1205368..1206540
  • length: 1173
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGTTAGAATTTGAACAAGGATTTAATCATTTAGCGACTTTAAAGGTCATTGGTGTAGGT
    GGTGGCGGTAACAACGCCGTAAACCGAATGATTGACCACGGAATGAATAATGTTGAATTT
    ATCGCTATCAACACAGACGGTCAAGCTTTAAACTTATCTAAAGCTGAATCTAAAATCCAA
    ATCGGTGAAAAATTAACACGTGGTTTAGGAGCAGGAGCTAATCCTGAAATCGGTAAAAAA
    GCTGCAGAGGAATCTCGTGAACAAATTGAAGATGCAATCCAAGGTGCAGACATGGTATTT
    GTTACTTCTGGTATGGGTGGCGGAACTGGTACTGGTGCAGCACCAGTCGTTGCTAAAATT
    GCAAAAGAAATGGGCGCATTAACTGTTGGTGTTGTAACTCGTCCATTTAGTTTTGAAGGA
    CGTAAACGTCAAACTCAAGCTGCTGCTGGAGTAGAAGCTATGAAAGCTGCAGTAGATACA
    TTAATCGTTATACCAAATGACCGTTTATTAGATATCGTTGACAAATCTACGCCAATGATG
    GAAGCATTTAAAGAAGCTGACAACGTGTTACGCCAAGGTGTACAAGGTATCTCAGACTTA
    ATCGCTGTTTCTGGTGAAGTAAACTTAGACTTTGCAGACGTTAAGACAATTATGTCTAAC
    CAAGGTTCTGCATTAATGGGTATTGGTGTTTCTTCTGGTGAAAATAGAGCGGTAGAAGCT
    GCTAAAAAAGCAATCTCTTCTCCATTACTTGAAACATCTATCGTTGGTGCACAAGGTGTG
    CTTATGAATATTACTGGTGGCGAGTCATTGTCATTATTTGAAGCACAAGAGGCTGCTGAT
    ATTGTCCAAGATGCTGCAGATGAAGACGTTAATATGATTTTCGGTACAGTTATTAATCCT
    GAATTACAAGATGAGATTGTTGTAACAGTTATTGCAACTGGTTTTGATGACAAACCAACA
    TCACATGGTCGTAAATCTGGTAGCACTGGATTCGGAACAAGCGTAAATACTTCTAGCAAT
    GCAACTTCTAAAGATGAATCATTCACTTCAAATTCATCAAATGCACAAGCAACTGATAGT
    GTAAGTGAAAGAACACATACAACTAAAGAAGATGATATTCCTAGCTTCATTAGAAATAGA
    GAAGAAAGACGTTCAAGAAGAACAAGACGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1173

Protein[edit | edit source]

Protein Data Bank: 5H5G
Protein Data Bank: 5H5H
Protein Data Bank: 5H5I
Protein Data Bank: 5XDT
Protein Data Bank: 5XDU
Protein Data Bank: 5XDV
Protein Data Bank: 5XDW

General[edit | edit source]

  • locus tag: SACOL1199 [new locus tag: SACOL_RS06140 ]
  • symbol: FtsZ
  • description: cell division protein FtsZ
  • length: 390
  • theoretical pI: 4.60363
  • theoretical MW: 41036.7
  • GRAVY: -0.230769

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein FtsZ (TIGR00065; HMM-score: 453.9)
    and 2 more
    molybdenum cofactor synthesis domain (TIGR00177; HMM-score: 16.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine thiazole biosynthesis adenylyltransferase ThiF (TIGR02356; EC 2.7.7.73; HMM-score: 13.6)
  • TheSEED  :
    • Cell division protein FtsZ
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Bacterial Cytoskeleton  Cell division protein FtsZ (EC 3.4.24.-)
  • PFAM:
    NADP_Rossmann (CL0063) Tubulin; Tubulin/FtsZ family, GTPase domain (PF00091; HMM-score: 183)
    and 3 more
    Tubulin_C (CL0442) FtsZ_C; FtsZ family, C-terminal domain (PF12327; HMM-score: 117.7)
    CheC-like (CL0355) CheX; Chemotaxis phosphatase CheX (PF13690; HMM-score: 13.2)
    NADP_Rossmann (CL0063) NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 12.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9801
    • Cytoplasmic Membrane Score: 0.0112
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0085
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012601
    • TAT(Tat/SPI): 0.002616
    • LIPO(Sec/SPII): 0.002965
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDSVSERTHTTKEDDIPSFIRNREERRSRRTRR

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4] [5]
  • quantitative data / protein copy number per cell: 4452 [6]
  • interaction partners:
    SACOL1198(ftsA)cell division protein FtsA  [7] (data from MRSA252)
    SACOL1103(pdhB)pyruvate dehydrogenase complex E1 component subunit beta  [7] (data from MRSA252)
    SACOL1104(pdhC)branched-chain alpha-keto acid dehydrogenase E2  [7] (data from MRSA252)
    SACOL1105(pdhD)dihydrolipoamide dehydrogenase  [7] (data from MRSA252)
    SACOL1745(pyk)pyruvate kinase  [7] (data from MRSA252)
    SACOL2220(rplO)50S ribosomal protein L15  [7] (data from MRSA252)
    SACOL1702(rplU)50S ribosomal protein L21  [7] (data from MRSA252)
    SACOL1274(rpsB)30S ribosomal protein S2  [7] (data from MRSA252)
    SACOL2222(rpsE)30S ribosomal protein S5  [7] (data from MRSA252)
    SACOL2206(rpsI)30S ribosomal protein S9  [7] (data from MRSA252)
    SACOL2214(rpsK)30S ribosomal protein S11  [7] (data from MRSA252)
    SACOL0594(tuf)elongation factor Tu  [7] (data from MRSA252)
    SACOL0731LysR family transcriptional regulator  [7] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 198.62 h [8]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
    Profiling the surfacome of Staphylococcus aureus.
    Proteomics: 2010, 10(17);3082-96
    [PubMed:20662103] [WorldCat.org] [DOI] (I p)
  4. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  5. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  6. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  7. 7.00 7.01 7.02 7.03 7.04 7.05 7.06 7.07 7.08 7.09 7.10 7.11 7.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  8. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

Sang Hyeon Son, Hyung Ho Lee
The N-terminal domain of EzrA binds to the C terminus of FtsZ to inhibit Staphylococcus aureus FtsZ polymerization.
Biochem Biophys Res Commun: 2013, 433(1);108-14
[PubMed:23485464] [WorldCat.org] [DOI] (I p)