Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0688 [new locus tag: SACOL_RS03540 ]
- pan locus tag?: SAUPAN002507000
- symbol: SACOL0688
- pan gene symbol?: mntC
- synonym:
- product: ABC transporter substrate-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0688 [new locus tag: SACOL_RS03540 ]
- symbol: SACOL0688
- product: ABC transporter substrate-binding protein
- replicon: chromosome
- strand: -
- coordinates: 712981..713910
- length: 930
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236721 NCBI
- RefSeq: YP_185570 NCBI
- BioCyc: see SACOL_RS03540
- MicrobesOnline: 912166 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGAAAAAATTAGTACCTTTATTATTAGCCTTATTACTTCTAGTTGCTGCATGTGGTACT
GGTGGTAAACAAAGCAGTGATAAGTCAAATGGCAAATTAAAAGTAGTAACGACGAATTCA
ATTTTATATGATATGGCTAAAAATGTTGGTGGAGACAACGTCGATATTCATAGTATTGTA
CCTGTTGGTCAAGATCCTCATGAATATGAAGTTAAACCTAAAGATATTAAAAAGTTAACT
GACGCTGACGTTATTTTATACAACGGATTAAATTTAGAGACTGGTAACGGTTGGTTTGAA
AAAGCCTTAGAACAGGCTGGTAAATCATTAAAAGATAAAAAAGTTATCGCAGTATCAAAA
GATGTTAAACCTATCTATTTAAACGGTGAAGAAGGCAACAAAGATAAACAAGATCCACAC
GCATGGTTAAGTTTAGATAACGGTATTAAATACGTAAAAACAATTCAACAAACATTTATC
GATAACGACAAAAAACATAAAGCAGATTATGAAAAGCAAGGTAACAAATACATTGCTCAA
TTGGAAAAATTAAATAATGACAGTAAAGACAAATTTAATGACATTCCAAAAGAACAACGT
GCCATGATTACAAGTGAAGGTGCCTTCAAGTACTTCTCAAAACAATACGGTATTACACCA
GGTTATATTTGGGAAATTAACACTGAAAAACAAGGTACACCTGAACAAATGAGACAAGCT
ATTGAGTTTGTTAAAAAGCACAAATTAAAACACTTATTAGTAGAAACAAGTGTTGATAAG
AAAGCAATGGAAAGTTTATCTGAAGAAACGAAGAAAGATATCTTTGGTGAAGTGTACACA
GATTCAATCGGTAAAGAAGGCACTAAAGGTGACTCTTACTACAAAATGATGAAATCAAAT
ATTGAAACTGTACACGGAAGCATGAAATAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
930
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0688 [new locus tag: SACOL_RS03540 ]
- symbol: SACOL0688
- description: ABC transporter substrate-binding protein
- length: 309
- theoretical pI: 9.16314
- theoretical MW: 34740.5
- GRAVY: -0.703236
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Unknown substrate anchored repeat ABC transporter, substrate-binding protein (TIGR03772; HMM-score: 125.7)
- TheSEED :
- Manganese/zinc ABC transporter (EC 7.2.2.5), substrate-binding protein ScaA
- PFAM: Chelatase (CL0043) ZnuA; Zinc-uptake complex component A periplasmic (PF01297; HMM-score: 279)and 2 moreGlnB-like (CL0089) Nit_Regul_Hom; Uncharacterized protein, homolog of nitrogen regulatory protein PII (PF10126; HMM-score: 18.2)RNase_H (CL0219) Terminase-T7_RNaseH-like; Terminase Bacteriophage T7, Ribonuclease H-like domain (PF22530; HMM-score: 14.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.68
- Cellwall Score: 0.17
- Extracellular Score: 0.16
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9976
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.0014
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: -0.33
- Signal peptide possibility: 1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: LLVAACG
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000794
- TAT(Tat/SPI): 0.000059
- LIPO(Sec/SPII): 0.999024
- Cleavage Site: CS pos: 17-18. VAA-CG. Pr: 0.9988
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Lipoprotein [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: MntR* (repression) regulon
MntR* (TF) important in Manganese homeostasis; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ 3.0 3.1 3.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)