From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
  • pan locus tag?: SAUPAN002199000
  • symbol: SACOL0521
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
  • symbol: SACOL0521
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 527373..527690
  • length: 318
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCGCGGTGGCGGAAACATGCAACAAATGATGAAACAAATGCAAAAAATGCAAAAGAAA
    ATGGCTCAAGAACAAGAAAAACTTAAAGAAGAGCGTATTGTAGGAACAGCTGGCGGTGGC
    ATGGTTGCAGTTACTGTAACTGGTCATAAAGAAGTTGTCGACGTTGAAATCAAAGAAGAA
    GCTGTAGACCCAGACGATATTGAAATGCTACAAGACTTAGTGTTAGCAGCTACTAATGAA
    GCGATGAATAAAGCTGATGAGCTTACTCAAGAACGTTTAGGTAAACATACTCAAGGCTTA
    AACATCCCTGGAATGTGA
    60
    120
    180
    240
    300
    318

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL0521 [new locus tag: SACOL_RS02640 ]
  • symbol: SACOL0521
  • description: hypothetical protein
  • length: 105
  • theoretical pI: 4.74462
  • theoretical MW: 11597.3
  • GRAVY: -0.619048

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General DNA-binding protein, YbaB/EbfC family (TIGR00103; HMM-score: 100.9)
    and 4 more
    Metabolism Central intermediary metabolism Phosphorus compounds exopolyphosphatase (TIGR03706; EC 3.6.1.11; HMM-score: 16.5)
    Unknown function General alpha-NAC homolog (TIGR00264; HMM-score: 9.2)
    Cellular processes Cellular processes DNA transformation Bacteroides conjugative transposon TraJ protein (TIGR03782; HMM-score: 8.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 7.9)
  • TheSEED  :
    • Nucleoid-associated protein YaaK
    DNA Metabolism DNA repair DNA repair, bacterial RecFOR pathway  FIG000557: hypothetical protein co-occurring with RecR
    and 1 more
    DNA Metabolism DNA uptake, competence DNA processing cluster  FIG000557: hypothetical protein co-occurring with RecR
  • PFAM:
    no clan defined YbaB_DNA_bd; YbaB/EbfC DNA-binding family (PF02575; HMM-score: 111.6)
    and 9 more
    DUF2931; Protein of unknown function (DUF2931) (PF11153; HMM-score: 19.5)
    YajC; Preprotein translocase subunit (PF02699; HMM-score: 18.6)
    GIT_CC; GIT coiled-coil Rho guanine nucleotide exchange factor (PF16559; HMM-score: 15.1)
    FKBP_N; Domain amino terminal to FKBP-type peptidyl-prolyl isomerase (PF01346; HMM-score: 14.5)
    GADPH_aa-bio_dh (CL0139) Semialdhyde_dhC; Semialdehyde dehydrogenase, dimerisation domain (PF02774; HMM-score: 14.4)
    Glutaminase_I (CL0014) Peptidase_S51; Peptidase family S51 (PF03575; HMM-score: 13.6)
    no clan defined DUF2935; Domain of unknown function (DUF2935) (PF11155; HMM-score: 13.2)
    DUF863; Plant protein of unknown function (DUF863) (PF05904; HMM-score: 11.9)
    Oxa1 (CL0376) 60KD_IMP; 60Kd inner membrane protein (PF02096; HMM-score: 6.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.83
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014356
    • TAT(Tat/SPI): 0.003446
    • LIPO(Sec/SPII): 0.001334
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MRGGGNMQQMMKQMQKMQKKMAQEQEKLKEERIVGTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPGM

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 789 [4]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 41.01 h [5]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL0521&oldid=98140"