Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2056 [new locus tag: SACOL_RS10760 ]
- pan locus tag?: SAUPAN005335000
- symbol: rsbV
- pan gene symbol?: rsbV
- synonym:
- product: anti-anti-sigma factor RsbV
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2056 [new locus tag: SACOL_RS10760 ]
- symbol: rsbV
- product: anti-anti-sigma factor RsbV
- replicon: chromosome
- strand: -
- coordinates: 2122418..2122744
- length: 327
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237741 NCBI
- RefSeq: YP_186872 NCBI
- BioCyc: see SACOL_RS10760
- MicrobesOnline: 913533 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATCTTAATATAGAAACAACCACTCAAGATAAATTTTACGAAGTTAAAGTCGGTGGA
GAATTAGATGTTTATACTGTGCCTGAATTAGAAGAGGTTTTAACACCTATGAGACAAGAT
GGAACTCGTGATATTTATGTTAATTTAGAAAATGTGAGTTATATGGATTCGACAGGTTTA
GGTTTATTCGTAGGTACATTAAAAGCATTAAACCAAAATGATAAAGAACTATACATTTTA
GGTGTGTCAGATCGTATCGGTAGACTATTTGAAATTACTGGTCTTAAGGATTTAATGCAT
GTTAATGAAGGAACGGAGGTCGAATAA60
120
180
240
300
327
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2056 [new locus tag: SACOL_RS10760 ]
- symbol: RsbV
- description: anti-anti-sigma factor RsbV
- length: 108
- theoretical pI: 4.04316
- theoretical MW: 12204.7
- GRAVY: -0.269444
⊟Function[edit | edit source]
- ⊞TIGRFAM: Regulatory functions Protein interactions anti-anti-sigma factor (TIGR00377; HMM-score: 117.5)and 2 more
- ⊞TheSEED :
- Anti-sigma B factor antagonist RsbV
Stress Response Stress Response - no subcategory SigmaB stress responce regulation anti sigma b factor antagonist RsbVand 1 more - ⊞PFAM: STAS (CL0502) STAS; STAS domain (PF01740; HMM-score: 69.4)and 1 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNLNIETTTQDKFYEVKVGGELDVYTVPELEEVLTPMRQDGTRDIYVNLENVSYMDSTGLGLFVGTLKALNQNDKELYILGVSDRIGRLFEITGLKDLMHVNEGTEVE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 4401 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: rpoF < rsbW < rsbV < rsbU
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 22.52 h [7]
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
S Wu, H de Lencastre, A Tomasz
Sigma-B, a putative operon encoding alternate sigma factor of Staphylococcus aureus RNA polymerase: molecular cloning and DNA sequencing.
J Bacteriol: 1996, 178(20);6036-42
[PubMed:8830703] [WorldCat.org] [DOI] (P p)