Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1223 [new locus tag: SA_RS06950 ]
- pan locus tag?: SAUPAN003803000
- symbol: SA1223
- pan gene symbol?: cvfB
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1223 [new locus tag: SA_RS06950 ]
- symbol: SA1223
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1396031..1396933
- length: 903
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124062 NCBI
- RefSeq: NP_374504 NCBI
- BioCyc: see SA_RS06950
- MicrobesOnline: 103530 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGGCATTAGACAAAGATATAGTAGGTTCTATAGAATTCCTTGAAGTAGTAGGGTTACAA
GGCTCAACTTACCTTTTAAAAGGACCAAACGGTGAAAACGTAAAGTTAAACCAATCAGAA
ATGAACGATGATGATGAATTAGAAGTAGGTGAAGAATATAGTTTCTTCATTTATCCAAAC
CGTTCAGGTGAATTATTTGCAACTCAAAATATGCCTGATATTACGAAAGATAAATATGAT
TTTGCTAAAGTACTTAAAACGGATCGCGATGGGGCACGTATAGATGTTGGTTTACCCCGT
GAAGTGTTAGTACCATGGGAAGATTTACCAAAAGTGAAATCACTATGGCCACAACCTGGT
GATCATTTGCTAGTTACATTACGAATTGACCGTGAGAATCATATGTATGGACGTTTAGCG
AGTGAATCTGTTGTAGAAAATATGTTTACACCTGTACACGATGATAATTTAAAAAACGAA
GTCATTGAAGCCAAACCTTACCGCGTATTACGAATTGGTAGCTTCTTATTAAGCGAATCA
GGTTACAAAATTTTCGTACATGAATCAGAACGTAAAGCTGAACCAAGATTAGGTGAATCT
GTTCAAGTTAGAATTATCGGGCATAATGATAAAGGTGAGTTAAATGGTTCATTTTTACCA
CTTGCACATGAACGTTTAGACGATGACGGCCAAGTCATCTTTGATTTACTAGTTGAATAT
GATGGTGAATTACCATTCTGGGACAAATCAAGCCCTGAAGCGATTAAAGAAGTATTCAAT
ATGAGTAAAGGTTCATTCAAACGTGCAATCGGTCACTTATATAAACAGAAGATTATTAAT
ATAGAAACAGGTAAAATCACTTTAACTAAAAAAGGTTGGAGTCGAATTGACTCAAAAGAA
TAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
903
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1223 [new locus tag: SA_RS06950 ]
- symbol: SA1223
- description: hypothetical protein
- length: 300
- theoretical pI: 4.82893
- theoretical MW: 34184.5
- GRAVY: -0.500667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Uncharacterized S1 RNA binding domain protein YitL
- PFAM: HTH (CL0123) CvfB_WH; CvfB-like winged helix domain (PF17783; HMM-score: 79.4)and 4 moreOB (CL0021) CvfB_2nd; Virulence regulatory factor CvfB, second domain (PF21543; HMM-score: 62.2)CvfB_1st; CvfB first S1-like domain (PF21191; HMM-score: 53.4)S1_2; S1 domain (PF13509; HMM-score: 39.8)S1; S1 RNA binding domain (PF00575; HMM-score: 17.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9794
- Cytoplasmic Membrane Score: 0.0161
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0043
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005867
- TAT(Tat/SPI): 0.002812
- LIPO(Sec/SPII): 0.002347
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPNRSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPGDHLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSESGYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEYDGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKITLTKKGWSRIDSKE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA0033 (aadD) kanamycin nucleotidyltransferase [1] (data from MRSA252) SA1075 (acpP) acyl carrier protein [1] (data from MRSA252) SA2027 (adk) adenylate kinase [1] (data from MRSA252) SA2428 (arcA) arginine deiminase [1] (data from MRSA252) SA0564 (argS) arginyl-tRNA synthetase [1] (data from MRSA252) SA1905 (atpD) ATP synthase F0F1 subunit beta [1] (data from MRSA252) SA1046 (carB) carbamoyl phosphate synthase large subunit [1] (data from MRSA252) SA1557 (ccpA) catabolite control protein A [1] (data from MRSA252) SA1309 (cmk) cytidylate kinase [1] (data from MRSA252) SA0471 (cysK) hypothetical protein [1] (data from MRSA252) SA1887 (ddl) D-alanyl-alanine synthetase A [1] (data from MRSA252) SA1073 (fabD) malonyl CoA-ACP transacylase [1] (data from MRSA252) SA0842 (FabH) 3-oxoacyl-ACP synthase [1] (data from MRSA252) SA0869 (fabI) enoyl-ACP reductase [1] (data from MRSA252) SA1901 (fabZ) (3R)-hydroxymyristoyl-ACP dehydratase [1] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SA1102 (frr) ribosome recycling factor [1] (data from MRSA252) SA1028 (ftsA) cell division protein [1] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SA1716 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [1] (data from MRSA252) SA1715 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) SA1367 (gcvT) glycine cleavage system aminomethyltransferase T [1] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA1837 (groES) co-chaperonin GroES [1] (data from MRSA252) SA1305 (hu) DNA-binding protein II [1] (data from MRSA252) SA1036 (ileS) isoleucyl-tRNA synthetase [1] (data from MRSA252) SA0512 (ilvE) branched-chain amino acid aminotransferase [1] (data from MRSA252) SA1112 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SA1504 (infC) translation initiation factor IF-3 [1] (data from MRSA252) SA2356 (isaA) hypothetical protein [1] (data from MRSA252) SA0241 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) SA1170 (katA) catalase [1] (data from MRSA252) SA0232 (lctE) L-lactate dehydrogenase [1] (data from MRSA252) SA1579 (leuS) leucyl-tRNA synthetase [1] (data from MRSA252) SA0898 (menB) naphthoate synthase [1] (data from MRSA252) SA1963 (mtlD) mannitol-1-phosphate 5-dehydrogenase [1] (data from MRSA252) SA1926 (murZ) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SA1301 (ndk) nucleoside diphosphate kinase [1] (data from MRSA252) SA1109 (nusA) transcription elongation factor NusA [1] (data from MRSA252) SA2392 (panB) 3-methyl-2-oxobutanoate hydroxymethyltransferase [1] (data from MRSA252) SA1188 (parE) DNA topoisomerase IV subunit B [1] (data from MRSA252) SA1609 (pckA) phosphoenolpyruvate carboxykinase [1] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA1521 (pfkA) 6-phosphofructokinase [1] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [1] (data from MRSA252) SA1117 (pnpA) polynucleotide phosphorylase [1] (data from MRSA252) SA1106 (proS) prolyl-tRNA synthetase [1] (data from MRSA252) SA0458 (prs) ribose-phosphate pyrophosphokinase [1] (data from MRSA252) SA0935 (ptsI) phosphoenolpyruvate-protein phosphatase [1] (data from MRSA252) SA0454 (purR) pur operon repressor [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA1044 (pyrC) dihydroorotase [1] (data from MRSA252) SA2341 (rocA) 1-pyrroline-5-carboxylate dehydrogenase [1] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SA0014 (rplI) 50S ribosomal protein L9 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA2017 (rplM) 50S ribosomal protein L13 [1] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SA2032 (rplR) 50S ribosomal protein L18 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SA2036 (rplX) 50S ribosomal protein L24 [1] (data from MRSA252) SA1471 (rpmA) 50S ribosomal protein L27 [1] (data from MRSA252) SA1067 (rpmB) 50S ribosomal protein L28 [1] (data from MRSA252) SA2039 (rpmC) 50S ribosomal protein L29 [1] (data from MRSA252) SA1922 (rpmE2) 50S ribosomal protein L31 [1] (data from MRSA252) SA1503 (rpmI) 50S ribosomal protein L35 [1] (data from MRSA252) SA2023 (rpoA) DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SA0501 (rpoC) DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [1] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SA0354 (rpsR) 30S ribosomal protein S18 [1] (data from MRSA252) SA2043 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SA1404 (rpsU) 30S ribosomal protein S21 [1] (data from MRSA252) SA1871 (rsbV) anti-sigmaB factor antagonist [1] (data from MRSA252) SA1382 (sodA) superoxide dismutase SodA [1] (data from MRSA252) SA0456 (spoVG) regulatory protein SpoVG [1] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SA1506 (thrS) threonyl-tRNA synthetase [1] (data from MRSA252) SA1177 (tkt) transketolase [1] (data from MRSA252) SA1100 (tsf) elongation factor Ts [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) SA0231 hypothetical protein [1] (data from MRSA252) SA0295 hypothetical protein [1] (data from MRSA252) SA0342 hypothetical protein [1] (data from MRSA252) SA0437 hypothetical protein [1] (data from MRSA252) SA0466 hypothetical protein [1] (data from MRSA252) SA0468 hypothetical protein [1] (data from MRSA252) SA0508 2-amino-3-ketobutyrate CoA ligase [1] (data from MRSA252) SA0511 hypothetical protein [1] (data from MRSA252) SA0587 hypothetical protein [1] (data from MRSA252) SA0605 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) SA0627 hypothetical protein [1] (data from MRSA252) SA0637 hypothetical protein [1] (data from MRSA252) SA0790 hypothetical protein [1] (data from MRSA252) SA0859 hypothetical protein [1] (data from MRSA252) SA0873 hypothetical protein [1] (data from MRSA252) SA0940 hypothetical protein [1] (data from MRSA252) SA1032 hypothetical protein [1] (data from MRSA252) SA1069 hypothetical protein [1] (data from MRSA252) SA1256 methionine sulfoxide reductase B [1] (data from MRSA252) SA1360 Xaa-Pro dipeptidase [1] (data from MRSA252) SA1365 glycine dehydrogenase subunit 2 [1] (data from MRSA252) SA1387 hypothetical protein [1] (data from MRSA252) SA1423 hypothetical protein [1] (data from MRSA252) SA1443 hypothetical protein [1] (data from MRSA252) SA1528 hypothetical protein [1] (data from MRSA252) SA1532 hypothetical protein [1] (data from MRSA252) SA1549 hypothetical protein [1] (data from MRSA252) SA1558 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase [1] (data from MRSA252) SA1559 hypothetical protein [1] (data from MRSA252) SA1563 hypothetical protein [1] (data from MRSA252) SA1565 hypothetical protein [1] (data from MRSA252) SA1572 dipeptidase PepV [1] (data from MRSA252) SA1599 translaldolase [1] (data from MRSA252) SA1743 hypothetical protein [1] (data from MRSA252) SA2098 glycerate dehydrogenase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)