Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1443 [new locus tag: SA_RS08135 ]
- pan locus tag?: SAUPAN004211000
- symbol: SA1443
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1443 [new locus tag: SA_RS08135 ]
- symbol: SA1443
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1645436..1645744
- length: 309
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124285 NCBI
- RefSeq: NP_374728 NCBI
- BioCyc: see SA_RS08135
- MicrobesOnline: 103754 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACTGAACATAATCATGATTCACAACTAGAAATTAATAACGAAGAAGAATTATTAACT
TTATTCGATGAAGAGGGAAATGAAGTTTTATACCGAAAAGTTTTAGAATTTTATCATCCT
GAATTCAAAAAAGAGTATGTTATCTTAGCTGAAGAAGGTGCTCAATCAGATGAAGACGAT
ATGATTGAGCTTGTACCAATGATCAATGAACCAGATGAGTCAGGTGACGGTGGTAAGTTA
GTACCAATCGAAACTGATGAAGAATGGGACATGATTGAAGAAGTTGTAAATACTGAAATG
GAAGAATAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1443 [new locus tag: SA_RS08135 ]
- symbol: SA1443
- description: hypothetical protein
- length: 102
- theoretical pI: 3.56659
- theoretical MW: 11948.9
- GRAVY: -0.813725
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001044
- TAT(Tat/SPI): 0.000215
- LIPO(Sec/SPII): 0.000193
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTEHNHDSQLEINNEEELLTLFDEEGNEVLYRKVLEFYHPEFKKEYVILAEEGAQSDEDDMIELVPMINEPDESGDGGKLVPIETDEEWDMIEEVVNTEMEE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA0471 (cysK) hypothetical protein [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SA0503 (rpsL) 30S ribosomal protein S12 [1] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SA0223 hypothetical protein [1] (data from MRSA252) SA0224 hypothetical protein [1] (data from MRSA252) SA0627 hypothetical protein [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA1443 < SA1444 < SA1445 < alaS
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)