From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1516 [new locus tag: NWMN_RS08525 ]
  • pan locus tag?: SAUPAN004211000
  • symbol: NWMN_1516
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1516 [new locus tag: NWMN_RS08525 ]
  • symbol: NWMN_1516
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1680980..1681288
  • length: 309
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACTGAACATAATCATGATTCACAACTAGAAATTAATAACGAAGAAGAATTATTAACT
    TTATTCGATGAAGAGGGAAATGAAGTTTTATACCGAAAAGTTTTAGAATTTTATCATCCT
    GAATTCAAAAAAGAGTATGTTATCTTAGCTGAAGAAGGTGCTCAATCAGATGAAGACGAT
    ATGATTGAGCTTGTACCAATGATCAATGAACCAGATGAGTCAGGTGACGGTGGTAAGTTA
    GTACCAATCGAAACTGATGAAGAATGGGACATGATTGAAGAAGTTGTAAATACTGAAATG
    GAAGAATAA
    60
    120
    180
    240
    300
    309

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1516 [new locus tag: NWMN_RS08525 ]
  • symbol: NWMN_1516
  • description: hypothetical protein
  • length: 102
  • theoretical pI: 3.56659
  • theoretical MW: 11948.9
  • GRAVY: -0.813725

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108372: hypothetical protein
  • PFAM:
    no clan defined DUF1292; Protein of unknown function (DUF1292) (PF06949; HMM-score: 39.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9972
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0025
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001044
    • TAT(Tat/SPI): 0.000215
    • LIPO(Sec/SPII): 0.000193
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTEHNHDSQLEINNEEELLTLFDEEGNEVLYRKVLEFYHPEFKKEYVILAEEGAQSDEDDMIELVPMINEPDESGDGGKLVPIETDEEWDMIEEVVNTEMEE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    NWMN_0167(fadA)acetyl-CoA acetyltransferase-like protein  [1] (data from MRSA252)
    NWMN_0168(fadB)3-hydroxyacyl-CoA dehydrogenase FadB-like protein  [1] (data from MRSA252)
    NWMN_2151(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    NWMN_1166(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_0507(rpsL)30S ribosomal protein S12  [1] (data from MRSA252)
    NWMN_1155(sucC)succinyl-CoA synthetase subunit beta  [1] (data from MRSA252)
    NWMN_0475cysteine synthase-like protein  [1] (data from MRSA252)
    NWMN_0641hypothetical protein  [1] (data from MRSA252)
    NWMN_2086alkaline shock protein 23  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]