Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2045 [new locus tag: SA_RS11755 ]
- pan locus tag?: SAUPAN005700000
- symbol: rplW
- pan gene symbol?: rplW
- synonym:
- product: 50S ribosomal protein L23
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2045 [new locus tag: SA_RS11755 ]
- symbol: rplW
- product: 50S ribosomal protein L23
- replicon: chromosome
- strand: -
- coordinates: 2306718..2306993
- length: 276
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124966 NCBI
- RefSeq: NP_375361 NCBI
- BioCyc: see SA_RS11755
- MicrobesOnline: 104387 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAAGCAAGAGATATTCTTAAGCGCCCCGTAATCACTGAGAAATCTTCTGAAGCAATG
GCTGAAGACAAATACACTTTCGACGTTGATACTCGTGTTAACAAAACACAAGTAAAAATG
GCAGTTGAAGAAATCTTCAACGTAAAAGTTGCAAGTGTTAATATCATGAATTACAAACCT
AAGAAAAAACGTATGGGCCGTTACCAAGGCTATACAAACAAAAGAAGAAAAGCGATTGTA
ACTCTTAAAGAAGGATCAATCGACTTATTTAACTAA60
120
180
240
276
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA2045 [new locus tag: SA_RS11755 ]
- symbol: RplW
- description: 50S ribosomal protein L23
- length: 91
- theoretical pI: 10.4702
- theoretical MW: 10605.3
- GRAVY: -0.706593
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL23 (TIGR03636; HMM-score: 36.8)
- TheSEED :
- LSU ribosomal protein L23p (L23Ae)
- PFAM: no clan defined Ribosomal_L23; Ribosomal protein L23 (PF00276; HMM-score: 114.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6135
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.3855
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012683
- TAT(Tat/SPI): 0.000806
- LIPO(Sec/SPII): 0.001254
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLFN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA1984 (asp23) alkaline shock protein 23 [2] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [2] (data from MRSA252) SA0723 (clpP) ATP-dependent Clp protease proteolytic subunit [2] (data from MRSA252) SA0471 (cysK) hypothetical protein [2] (data from MRSA252) SA1940 (deoD) purine nucleoside phosphorylase [2] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [2] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA1074 (fabG) 3-oxoacyl-ACP reductase [2] (data from MRSA252) SA1927 (fbaA) fructose-bisphosphate aldolase [2] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [2] (data from MRSA252) SA0915 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [2] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [2] (data from MRSA252) SA1510 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [2] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [2] (data from MRSA252) SA1836 (groEL) molecular chaperone GroEL [2] (data from MRSA252) SA1036 (ileS) isoleucyl-tRNA synthetase [2] (data from MRSA252) SA1504 (infC) translation initiation factor IF-3 [2] (data from MRSA252) SA0245 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [2] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [2] (data from MRSA252) SA1109 (nusA) transcription elongation factor NusA [2] (data from MRSA252) SA1609 (pckA) phosphoenolpyruvate carboxykinase [2] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [2] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [2] (data from MRSA252) SA0934 (ptsH) phosphocarrier protein HPr [2] (data from MRSA252) SA0935 (ptsI) phosphoenolpyruvate-protein phosphatase [2] (data from MRSA252) SA1520 (pykA) pyruvate kinase [2] (data from MRSA252) SA1044 (pyrC) dihydroorotase [2] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [2] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [2] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [2] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [2] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [2] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SA0014 (rplI) 50S ribosomal protein L9 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [2] (data from MRSA252) SA2040 (rplP) 50S ribosomal protein L16 [2] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [2] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [2] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SA2036 (rplX) 50S ribosomal protein L24 [2] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [2] (data from MRSA252) SA1471 (rpmA) 50S ribosomal protein L27 [2] (data from MRSA252) SA1922 (rpmE2) 50S ribosomal protein L31 [2] (data from MRSA252) SA1308 (rpsA) 30S ribosomal protein S1 [2] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [2] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [2] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [2] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [2] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SA0503 (rpsL) 30S ribosomal protein S12 [2] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [2] (data from MRSA252) SA1414 (rpsT) 30S ribosomal protein S20 [2] (data from MRSA252) SA1499 (tig) trigger factor [2] (data from MRSA252) SA1177 (tkt) transketolase [2] (data from MRSA252) SA0506 (tuf) elongation factor Tu [2] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [2] (data from MRSA252) SA0295 hypothetical protein [2] (data from MRSA252) SA0437 hypothetical protein [2] (data from MRSA252) SA0511 hypothetical protein [2] (data from MRSA252) SA0627 hypothetical protein [2] (data from MRSA252) SA0759 hypothetical protein [2] (data from MRSA252) SA0802 hypothetical protein [2] (data from MRSA252) SA0859 hypothetical protein [2] (data from MRSA252) SA1271 threonine dehydratase [2] (data from MRSA252) SA1365 glycine dehydrogenase subunit 2 [2] (data from MRSA252) SA1387 hypothetical protein [2] (data from MRSA252) SA1443 hypothetical protein [2] (data from MRSA252) SA1528 hypothetical protein [2] (data from MRSA252) SA1735 manganese-dependent inorganic pyrophosphatase [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: adk < secY < rplO < rpmD < rpsE < rplR < rplF < rpsH < rpsN < rplE < rplX < rplN < rpsQ < rpmC < rplP < rpsC < rplV < rpsS < rplB < rplW < rplD < rplC < rpsJ
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 2.55 2.56 2.57 2.58 2.59 2.60 2.61 2.62 2.63 2.64 2.65 2.66 2.67 2.68 2.69 2.70 2.71 2.72 2.73 2.74 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)