Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS11755 [old locus tag: SA2045 ]
- pan locus tag?: SAUPAN005700000
- symbol: SA_RS11755
- pan gene symbol?: rplW
- synonym:
- product: 50S ribosomal protein L23
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS11755 [old locus tag: SA2045 ]
- symbol: SA_RS11755
- product: 50S ribosomal protein L23
- replicon: chromosome
- strand: -
- coordinates: 2306718..2306993
- length: 276
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAAGCAAGAGATATTCTTAAGCGCCCCGTAATCACTGAGAAATCTTCTGAAGCAATG
GCTGAAGACAAATACACTTTCGACGTTGATACTCGTGTTAACAAAACACAAGTAAAAATG
GCAGTTGAAGAAATCTTCAACGTAAAAGTTGCAAGTGTTAATATCATGAATTACAAACCT
AAGAAAAAACGTATGGGCCGTTACCAAGGCTATACAAACAAAAGAAGAAAAGCGATTGTA
ACTCTTAAAGAAGGATCAATCGACTTATTTAACTAA60
120
180
240
276
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA_RS11755 [old locus tag: SA2045 ]
- symbol: SA_RS11755
- description: 50S ribosomal protein L23
- length: 91
- theoretical pI: 10.4702
- theoretical MW: 10605.3
- GRAVY: -0.706593
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL23 (TIGR03636; HMM-score: 36.8)
- TheSEED: see SA2045
- PFAM: no clan defined Ribosomal_L23; Ribosomal protein L23 (PF00276; HMM-score: 114.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6135
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.3855
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012683
- TAT(Tat/SPI): 0.000806
- LIPO(Sec/SPII): 0.001254
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLFN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA_RS11130 (deoA) pyrimidine-nucleoside phosphorylase [2] (data from MRSA252) SA_RS06280 (nusA) transcription termination/antitermination protein NusA [2] (data from MRSA252) SA_RS00215 50S ribosomal protein L9 [2] (data from MRSA252) SA_RS01275 formate acetyltransferase [2] (data from MRSA252) SA_RS01445 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [2] (data from MRSA252) SA_RS01710 5'-nucleotidase, lipoprotein e(P4) family [2] (data from MRSA252) SA_RS02490 YbaB/EbfC family nucleoid-associated protein [2] (data from MRSA252) SA_RS02650 50S ribosomal protein L25/general stress protein Ctc [2] (data from MRSA252) SA_RS02710 cysteine synthase [2] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [2] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [2] (data from MRSA252) SA_RS02920 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA_RS02945 30S ribosomal protein S12 [2] (data from MRSA252) SA_RS02950 30S ribosomal protein S7 [2] (data from MRSA252) SA_RS02960 elongation factor Tu [2] (data from MRSA252) SA_RS02985 UDP-glucose 4-epimerase [2] (data from MRSA252) SA_RS04120 ATP-dependent Clp protease proteolytic subunit [2] (data from MRSA252) SA_RS04140 aldehyde dehydrogenase [2] (data from MRSA252) SA_RS04160 enolase [2] (data from MRSA252) SA_RS04325 arsenate reductase [2] (data from MRSA252) SA_RS04575 NADH dehydrogenase [2] (data from MRSA252) SA_RS04865 oligoendopeptidase F [2] (data from MRSA252) SA_RS05190 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [2] (data from MRSA252) SA_RS05295 phosphocarrier protein HPr [2] (data from MRSA252) SA_RS05300 phosphoenolpyruvate--protein phosphotransferase [2] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA_RS05895 isoleucine--tRNA ligase [2] (data from MRSA252) SA_RS05935 dihydroorotase [2] (data from MRSA252) SA_RS06085 beta-ketoacyl-ACP reductase [2] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [2] (data from MRSA252) SA_RS06490 glutamine synthetase [2] (data from MRSA252) SA_RS06690 transketolase [2] (data from MRSA252) SA_RS07205 serine/threonine dehydratase [2] (data from MRSA252) SA_RS07400 30S ribosomal protein S1 [2] (data from MRSA252) SA_RS07725 glycine dehydrogenase [2] (data from MRSA252) SA_RS07845 DEAD/DEAH box family ATP-dependent RNA helicase [2] (data from MRSA252) SA_RS07955 molecular chaperone DnaK [2] (data from MRSA252) SA_RS07985 30S ribosomal protein S20 [2] (data from MRSA252) SA_RS08135 hypothetical protein [2] (data from MRSA252) SA_RS08285 50S ribosomal protein L27 [2] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [2] (data from MRSA252) SA_RS08435 trigger factor [2] (data from MRSA252) SA_RS08460 50S ribosomal protein L20 [2] (data from MRSA252) SA_RS08470 translation initiation factor IF-3 [2] (data from MRSA252) SA_RS08505 aldehyde dehydrogenase [2] (data from MRSA252) SA_RS08545 isocitrate dehydrogenase (NADP(+)) [2] (data from MRSA252) SA_RS08560 pyruvate kinase [2] (data from MRSA252) SA_RS08600 universal stress protein [2] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [2] (data from MRSA252) SA_RS08760 formate--tetrahydrofolate ligase [2] (data from MRSA252) SA_RS09060 phosphoenolpyruvate carboxykinase (ATP) [2] (data from MRSA252) SA_RS09960 manganese-dependent inorganic pyrophosphatase [2] (data from MRSA252) SA_RS10535 molecular chaperone GroEL [2] (data from MRSA252) SA_RS11010 uracil phosphoribosyltransferase [2] (data from MRSA252) SA_RS11050 50S ribosomal protein L31 type B [2] (data from MRSA252) SA_RS11075 fructose-bisphosphate aldolase [2] (data from MRSA252) SA_RS11145 purine-nucleoside phosphorylase [2] (data from MRSA252) SA_RS11430 Asp23/Gls24 family envelope stress response protein [2] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [2] (data from MRSA252) SA_RS11630 50S ribosomal protein L17 [2] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [2] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [2] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [2] (data from MRSA252) SA_RS11705 50S ribosomal protein L5 [2] (data from MRSA252) SA_RS11710 50S ribosomal protein L24 [2] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [2] (data from MRSA252) SA_RS11730 50S ribosomal protein L16 [2] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [2] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [2] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [2] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [2] (data from MRSA252) SA_RS11765 50S ribosomal protein L3 [2] (data from MRSA252) SA_RS11770 30S ribosomal protein S10 [2] (data from MRSA252) SA_RS13735 malate:quinone oxidoreductase [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 2.55 2.56 2.57 2.58 2.59 2.60 2.61 2.62 2.63 2.64 2.65 2.66 2.67 2.68 2.69 2.70 2.71 2.72 2.73 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)