Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS11710 [old locus tag: SA2036 ]
- pan locus tag?: SAUPAN005691000
- symbol: SA_RS11710
- pan gene symbol?: rplX
- synonym:
- product: 50S ribosomal protein L24
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS11710 [old locus tag: SA2036 ]
- symbol: SA_RS11710
- product: 50S ribosomal protein L24
- replicon: chromosome
- strand: -
- coordinates: 2302772..2303089
- length: 318
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCATATCAAAAAAGGTGACAACGTTAAAGTTATCGCAGGTAAAGACAAAGGTAAAGAA
GGTAAAGTAATTGCTACTCTACCTAAAAAAGACCGTGTCGTTGTGGAAGGTGTTAACATT
ATGAAAAAACACCAAAAACCAACTCAATTAAATCCTGAAGGTGGAATCTTAGAAACAGAG
GCAGCAATCCATGTTTCTAATGTACAATTATTGGACCCTAAAACAAACGAACCAACTCGT
GTAGGTTACAAATTTGTTGATGGTAAAAAAGTTCGTATCGCTAAAAAATCTGGCGAAGAA
ATTAAATCTAATAATTAA60
120
180
240
300
318
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA_RS11710 [old locus tag: SA2036 ]
- symbol: SA_RS11710
- description: 50S ribosomal protein L24
- length: 105
- theoretical pI: 10.5873
- theoretical MW: 11536.4
- GRAVY: -0.722857
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01079; HMM-score: 136.5)and 3 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01080; HMM-score: 32.2)transcription elongation factor Spt5 (TIGR00405; HMM-score: 17.5)HAD phosphatase, family IIIB (TIGR01672; EC 3.1.3.-; HMM-score: 13.1)
- TheSEED: see SA2036
- PFAM: SH3 (CL0010) ribosomal_L24; Ribosomal proteins 50S L24/mitochondrial 39S L24 (PF17136; HMM-score: 106)and 6 moreKOW; KOW motif (PF00467; HMM-score: 37.5)KOW7_SPT5; Transcription elongation factor SPT5, seventh KOW domain (PF23287; HMM-score: 19.5)KOW4_SPT5; Transcription elongation factor SPT5, fourth KOW domain (PF23291; HMM-score: 19)Ribosomal_uL24m-like; Large ribosomal subunit protein uL24m (PF22682; HMM-score: 18.5)no clan defined SPP1_Dit; Siphovirus-type tail component, C-terminal domain (PF22768; HMM-score: 15.3)SH3 (CL0010) KOW2_Spt5; Transcription elongation factor SPT5, second KOW domain (PF23284; HMM-score: 11.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9348
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0649
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008389
- TAT(Tat/SPI): 0.000477
- LIPO(Sec/SPII): 0.002161
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETEAAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA_RS02095 alkyl hydroperoxide reductase subunit C [2] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [2] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [2] (data from MRSA252) SA_RS02920 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA_RS04575 NADH dehydrogenase [2] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA_RS05355 pyruvate dehydrogenase E1 component subunit beta [2] (data from MRSA252) SA_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [2] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [2] (data from MRSA252) SA_RS05860 cell division protein FtsZ [2] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [2] (data from MRSA252) SA_RS06225 30S ribosomal protein S2 [2] (data from MRSA252) SA_RS07060 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [2] (data from MRSA252) SA_RS07065 2-oxoglutarate dehydrogenase E1 component [2] (data from MRSA252) SA_RS07385 DNA-binding protein HU [2] (data from MRSA252) SA_RS07955 molecular chaperone DnaK [2] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [2] (data from MRSA252) SA_RS08435 trigger factor [2] (data from MRSA252) SA_RS08560 pyruvate kinase [2] (data from MRSA252) SA_RS08625 universal stress protein UspA [2] (data from MRSA252) SA_RS11430 Asp23/Gls24 family envelope stress response protein [2] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [2] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)