Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS08460 [old locus tag: SA1502 ]
- pan locus tag?: SAUPAN004297000
- symbol: SA_RS08460
- pan gene symbol?: rplT
- synonym:
- product: 50S ribosomal protein L20
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCCACGAGTTAAAGGTGGAACAGTAACAAGAGCGCGTCGTAAAAAAACGATTAAATTA
GCTAAAGGTTACTTCGGTTCAAAACATACATTATACAAAGTAGCTAAGCAACAAGTAATG
AAATCAGGTCAATATGCTTTCCGTGACCGTCGTCAACGTAAACGTGACTTCCGTAAATTA
TGGATTACACGTATCAACGCAGCAGCTCGTCAACATGAAATGAGCTACTCACGTTTAATG
AACGGTTTGAAAAAAGCTGGTATCGACATTAACCGTAAAATGTTATCAGAAATCGCAATT
TCTGACGAAAAAGCATTTGCTCAATTAGTAACTAAAGCTAAAGATGCTTTAAAATAA60
120
180
240
300
357
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA_RS08460 [old locus tag: SA1502 ]
- symbol: SA_RS08460
- description: 50S ribosomal protein L20
- length: 118
- theoretical pI: 11.8478
- theoretical MW: 13686.1
- GRAVY: -0.776271
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL20 (TIGR01032; HMM-score: 172.7)
- TheSEED: see SA1502
- PFAM: no clan defined Ribosomal_L20; Ribosomal protein L20 (PF00453; HMM-score: 166)and 1 moreFlpD; Methyl-viologen-reducing hydrogenase, delta subunit (PF02662; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010586
- TAT(Tat/SPI): 0.007502
- LIPO(Sec/SPII): 0.005094
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKLWITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDALK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA_RS01710 5'-nucleotidase, lipoprotein e(P4) family [2] (data from MRSA252) SA_RS02015 30S ribosomal protein S6 [2] (data from MRSA252) SA_RS02025 30S ribosomal protein S18 [2] (data from MRSA252) SA_RS02125 hypothetical protein [2] (data from MRSA252) SA_RS02615 pur operon repressor [2] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [2] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [2] (data from MRSA252) SA_RS02960 elongation factor Tu [2] (data from MRSA252) SA_RS03645 hypothetical protein [2] (data from MRSA252) SA_RS04160 enolase [2] (data from MRSA252) SA_RS04895 NAD(+) kinase [2] (data from MRSA252) SA_RS05325 ribonuclease J 1 [2] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [2] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [2] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [2] (data from MRSA252) SA_RS06325 ribonuclease J 2 [2] (data from MRSA252) SA_RS07385 DNA-binding protein HU [2] (data from MRSA252) SA_RS08230 bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase [2] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [2] (data from MRSA252) SA_RS08600 universal stress protein [2] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [2] (data from MRSA252) SA_RS08800 hypothetical protein [2] (data from MRSA252) SA_RS10845 DEAD/DEAH box family ATP-dependent RNA helicase [2] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [2] (data from MRSA252) SA_RS11630 50S ribosomal protein L17 [2] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [2] (data from MRSA252) SA_RS11645 30S ribosomal protein S13 [2] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [2] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [2] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [2] (data from MRSA252) SA_RS11705 50S ribosomal protein L5 [2] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [2] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [2] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [2] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [2] (data from MRSA252) SA_RS11755 50S ribosomal protein L23 [2] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [2] (data from MRSA252) SA_RS11765 50S ribosomal protein L3 [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L20 leader see SA1502
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)