Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2039 [new locus tag: SA_RS11725 ]
- pan locus tag?: SAUPAN005694000
- symbol: rpmC
- pan gene symbol?: rpmC
- synonym:
- product: 50S ribosomal protein L29
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2039 [new locus tag: SA_RS11725 ]
- symbol: rpmC
- product: 50S ribosomal protein L29
- replicon: chromosome
- strand: -
- coordinates: 2303812..2304021
- length: 210
- essential: yes DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124960 NCBI
- RefSeq: NP_375355 NCBI
- BioCyc: see SA_RS11725
- MicrobesOnline: 104381 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAAGCTAAGGAAATTAGAGACTTAACCACTTCAGAAATCGAAGAACAAATCAAATCT
TCAAAAGAAGAGCTTTTTAACCTACGCTTTCAGTTAGCTACAGGTCAATTAGAAGAAACT
GCACGTATTCGTACAGTAAGAAAAACGATTGCACGTCTAAAAACTGTTGCTCGTGAAAGA
GAAATTGAACAAAGTAAGGCTAATCAATAA60
120
180
210
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA2039 [new locus tag: SA_RS11725 ]
- symbol: RpmC
- description: 50S ribosomal protein L29
- length: 69
- theoretical pI: 10.3881
- theoretical MW: 8090.19
- GRAVY: -0.895652
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL29 (TIGR00012; HMM-score: 76.9)
- TheSEED :
- LSU ribosomal protein L29p (L35e)
- PFAM: Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 87)and 2 moreno clan defined MPH2; Maintenance of Photosystem II under High light 2 (PF20675; HMM-score: 14.1)HTH (CL0123) RIOX1_C_WH; Ribosomal oxygenase 1, C-terminal winged helix domain (PF21233; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9689
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0293
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004751
- TAT(Tat/SPI): 0.024387
- LIPO(Sec/SPII): 0.000866
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVAREREIEQSKANQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA1517 (citC) isocitrate dehydrogenase [1] (data from MRSA252) SA1887 (ddl) D-alanyl-alanine synthetase A [1] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SA1305 (hu) DNA-binding protein II [1] (data from MRSA252) SA1112 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SA1504 (infC) translation initiation factor IF-3 [1] (data from MRSA252) SA0686 (nrdE) ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SA1244 (odhB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA0944 (pdhB) pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [1] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SA1659 (prsA) hypothetical protein [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA1101 (pyrH) uridylate kinase [1] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SA2032 (rplR) 50S ribosomal protein L18 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SA2036 (rplX) 50S ribosomal protein L24 [1] (data from MRSA252) SA1067 (rpmB) 50S ribosomal protein L28 [1] (data from MRSA252) SA1922 (rpmE2) 50S ribosomal protein L31 [1] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SA0503 (rpsL) 30S ribosomal protein S12 [1] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SA0354 (rpsR) 30S ribosomal protein S18 [1] (data from MRSA252) SA2043 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SA1245 (sucA) 2-oxoglutarate dehydrogenase E1 [1] (data from MRSA252) SA0295 hypothetical protein [1] (data from MRSA252) SA0466 hypothetical protein [1] (data from MRSA252) SA0587 hypothetical protein [1] (data from MRSA252) SA0627 hypothetical protein [1] (data from MRSA252) SA0637 hypothetical protein [1] (data from MRSA252) SA0802 hypothetical protein [1] (data from MRSA252) SA0940 hypothetical protein [1] (data from MRSA252) SA1528 hypothetical protein [1] (data from MRSA252) SA1549 hypothetical protein [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)