From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2196 [new locus tag: SAUSA300_RS12110 ]
  • pan locus tag?: SAUPAN005694000
  • symbol: rpmC
  • pan gene symbol?: rpmC
  • synonym:
  • product: 50S ribosomal protein L29

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2196 [new locus tag: SAUSA300_RS12110 ]
  • symbol: rpmC
  • product: 50S ribosomal protein L29
  • replicon: chromosome
  • strand: -
  • coordinates: 2366524..2366745
  • length: 222
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGGTGAAACAAATGAAAGCTAAGGAAATTAGAGACTTAACCACTTCAGAAATCGAAGAA
    CAAATCAAATCTTCAAAAGAAGAGCTTTTTAACCTACGCTTTCAGTTAGCTACAGGTCAA
    TTAGAAGAAACTGCACGTATTCGTACAGTAAGAAAAACGATTGCACGTCTAAAAACTGTT
    GCTCGTGAAAGAGAAATTGAACAAAGTAAGGCTAATCAATAA
    60
    120
    180
    222


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_2196 [new locus tag: SAUSA300_RS12110 ]
  • symbol: RpmC
  • description: 50S ribosomal protein L29
  • length: 73
  • theoretical pI: 10.5595
  • theoretical MW: 8576.82
  • GRAVY: -0.864384

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL29 (TIGR00012; HMM-score: 76.7)
  • TheSEED  :
    • LSU ribosomal protein L29p (L35e)
    Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L29p (L35e)
  • PFAM:
    Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 86.8)
    and 5 more
    no clan defined MPH2; Maintenance of Photosystem II under High light 2 (PF20675; HMM-score: 14.1)
    HTH (CL0123) RIOX1_C_WH; Ribosomal oxygenase 1, C-terminal winged helix domain (PF21233; HMM-score: 13.8)
    no clan defined Mlp; Mlp lipoprotein family (PF03304; HMM-score: 13.6)
    DnaG_DnaB_bind; DNA primase DnaG DnaB-binding (PF08278; HMM-score: 12.9)
    Ribo_L29 (CL0346) MRP-L47; Mitochondrial 39-S ribosomal protein L47 (MRP-L47) (PF06984; HMM-score: 12.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9448
    • Cytoplasmic Membrane Score: 0.0041
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.0505
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00262
    • TAT(Tat/SPI): 0.011844
    • LIPO(Sec/SPII): 0.000459
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MVKQMKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVAREREIEQSKANQ

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]