Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2037 [new locus tag: SA_RS11715 ]
- pan locus tag?: SAUPAN005692000
- symbol: rplN
- pan gene symbol?: rplN
- synonym:
- product: 50S ribosomal protein L14
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2037 [new locus tag: SA_RS11715 ]
- symbol: rplN
- product: 50S ribosomal protein L14
- replicon: chromosome
- strand: -
- coordinates: 2303125..2303493
- length: 369
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124958 NCBI
- RefSeq: NP_375353 NCBI
- BioCyc: see SA_RS11715
- MicrobesOnline: 104379 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATCCAACAAGAAACACGCTTGAAAGTAGCAGACAACTCTGGTGCTCGTGAAGTTCTT
ACAATCAAAGTATTAGGTGGATCTGGTCGTAAAACAGCAAACATCGGCGATGTTATCGTA
TGTACTGTTAAAAATGCAACACCAGGTGGCGTTGTTAAAAAAGGTGACGTTGTCAAAGCT
GTAATCGTACGTACTAAGTCAGGTGTTCGTCGTAATGACGGTTCATACATCAAATTTGAT
GAAAATGCATGTGTTATCATCCGTGATGACAAAGGCCCACGTGGTACTCGTATCTTCGGA
CCTGTTGCTCGTGAATTACGTGAAGGTAACTTCATGAAAATCGTATCATTAGCACCAGAA
GTACTTTAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA2037 [new locus tag: SA_RS11715 ]
- symbol: RplN
- description: 50S ribosomal protein L14
- length: 122
- theoretical pI: 10.7254
- theoretical MW: 13135.2
- GRAVY: -0.141803
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL14 (TIGR01067; HMM-score: 192.3)and 1 more50S ribosomal protein uL14 (TIGR03673; HMM-score: 96.6)
- TheSEED :
- LSU ribosomal protein L14p (L23e)
- PFAM: no clan defined Ribosomal_L14; Ribosomal protein L14p/L23e (PF00238; HMM-score: 183.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0734
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.9265
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.091516
- TAT(Tat/SPI): 0.009224
- LIPO(Sec/SPII): 0.006493
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKAVIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPEVL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA1533 (ackA) acetate kinase [2] (data from MRSA252) SA2428 (arcA) arginine deiminase [2] (data from MRSA252) SA2425 (arcC) carbamate kinase [2] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [2] (data from MRSA252) SA1046 (carB) carbamoyl phosphate synthase large subunit [2] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [2] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [2] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [2] (data from MRSA252) SA0505 (fus) elongation factor G [2] (data from MRSA252) SA1510 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [2] (data from MRSA252) SA1112 (infB) translation initiation factor IF-2 [2] (data from MRSA252) SA1608 (metK) S-adenosylmethionine synthetase [2] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [2] (data from MRSA252) SA0686 (nrdE) ribonucleotide-diphosphate reductase subunit alpha [2] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [2] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [2] (data from MRSA252) SA0458 (prs) ribose-phosphate pyrophosphokinase [2] (data from MRSA252) SA1520 (pykA) pyruvate kinase [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [2] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [2] (data from MRSA252) SA0506 (tuf) elongation factor Tu [2] (data from MRSA252) SA0017 (vicR) response regulator [2] (data from MRSA252) SA0182 hypothetical protein [2] (data from MRSA252) SA0477 pyridoxal biosynthesis lyase PdxS [2] (data from MRSA252) SA0537 phosphomethylpyrimidine kinase [2] (data from MRSA252) SA0627 hypothetical protein [2] (data from MRSA252) SA0802 hypothetical protein [2] (data from MRSA252) SA0829 hypothetical protein [2] (data from MRSA252) SA1271 threonine dehydratase [2] (data from MRSA252) SA1528 hypothetical protein [2] (data from MRSA252) SA1532 hypothetical protein [2] (data from MRSA252) SA2327 pyruvate oxidase [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: adk < secY < rplO < rpmD < rpsE < rplR < rplF < rpsH < rpsN < rplE < rplX < rplN < rpsQ < rpmC < rplP < rpsC < rplV < rpsS < rplB < rplW < rplD < rplC < rpsJ
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)