Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0497 [new locus tag: SA_RS02915 ]
- pan locus tag?: SAUPAN002310000
- symbol: rplJ
- pan gene symbol?: rplJ
- synonym:
- product: 50S ribosomal protein L10
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0497 [new locus tag: SA_RS02915 ]
- symbol: rplJ
- product: 50S ribosomal protein L10
- replicon: chromosome
- strand: +
- coordinates: 577711..578211
- length: 501
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123302 NCBI
- RefSeq: NP_373750 NCBI
- BioCyc: see SA_RS02915
- MicrobesOnline: 102776 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGTCTGCTATCATTGAAGCTAAAAAACAACTAGTTGATGAAATTGCTGAGGTACTATCA
AATTCAGTTTCAACAGTAATCGTTGACTATCGTGGATTAACAGTAGCTGAAGTTACTGAC
TTACGTTCACAATTACGTGAAGCTGGTGTTGAGTATAAAGTATACAAAAACACTATGGTA
CGTCGTGCAGCTGAAAAAGCTGGTATCGAAGGCTTAGATGAATTCTTAACAGGTCCTACT
GCTATTGCAACTTCAAGTGAAGATGCTGTAGCTGCAGCGAAAGTAATTTCTGGATTTGCT
AAAGATCATGAAGCATTAGAAATTAAATCAGGTGTTATGGAAGGCAATGTTATTACAGCA
GAAGAAGTTAAAACTGTTGGTTCATTACCTTCACACGATGGTCTTGTATCTATGCTTTTA
TCAGTATTACAAGCTCCTGTACGCAACTTCGCTTATGCGGTTAAAGCTATTGGAGAACAA
AAAGAAGAAAACGCTGAATAA60
120
180
240
300
360
420
480
501
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0497 [new locus tag: SA_RS02915 ]
- symbol: RplJ
- description: 50S ribosomal protein L10
- length: 166
- theoretical pI: 4.49215
- theoretical MW: 17710
- GRAVY: 0.0246988
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis tRNA aminoacylation serine--tRNA ligase (TIGR00415; EC 6.1.1.11; HMM-score: 10.8)
- TheSEED :
- LSU ribosomal protein L10p (P0)
- PFAM: no clan defined Ribosomal_L10; Ribosomal protein L10 (PF00466; HMM-score: 103)and 1 moreP-loop_NTPase (CL0023) AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00194
- TAT(Tat/SPI): 0.000208
- LIPO(Sec/SPII): 0.000347
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMVRRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITAEEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA1907 (atpA) ATP synthase F0F1 subunit alpha [2] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [2] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [2] (data from MRSA252) SA1036 (ileS) isoleucyl-tRNA synthetase [2] (data from MRSA252) SA1608 (metK) S-adenosylmethionine synthetase [2] (data from MRSA252) SA0934 (ptsH) phosphocarrier protein HPr [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SA1922 (rpmE2) 50S ribosomal protein L31 [2] (data from MRSA252) SA0637 hypothetical protein [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L10 leader (transcription termination) regulon
L10 leader (RNA) important in Ribosome biogenesis; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)