From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0497 [new locus tag: SA_RS02915 ]
  • pan locus tag?: SAUPAN002310000
  • symbol: rplJ
  • pan gene symbol?: rplJ
  • synonym:
  • product: 50S ribosomal protein L10

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0497 [new locus tag: SA_RS02915 ]
  • symbol: rplJ
  • product: 50S ribosomal protein L10
  • replicon: chromosome
  • strand: +
  • coordinates: 577711..578211
  • length: 501
  • essential: yes [1] DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTCTGCTATCATTGAAGCTAAAAAACAACTAGTTGATGAAATTGCTGAGGTACTATCA
    AATTCAGTTTCAACAGTAATCGTTGACTATCGTGGATTAACAGTAGCTGAAGTTACTGAC
    TTACGTTCACAATTACGTGAAGCTGGTGTTGAGTATAAAGTATACAAAAACACTATGGTA
    CGTCGTGCAGCTGAAAAAGCTGGTATCGAAGGCTTAGATGAATTCTTAACAGGTCCTACT
    GCTATTGCAACTTCAAGTGAAGATGCTGTAGCTGCAGCGAAAGTAATTTCTGGATTTGCT
    AAAGATCATGAAGCATTAGAAATTAAATCAGGTGTTATGGAAGGCAATGTTATTACAGCA
    GAAGAAGTTAAAACTGTTGGTTCATTACCTTCACACGATGGTCTTGTATCTATGCTTTTA
    TCAGTATTACAAGCTCCTGTACGCAACTTCGCTTATGCGGTTAAAGCTATTGGAGAACAA
    AAAGAAGAAAACGCTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0497 [new locus tag: SA_RS02915 ]
  • symbol: RplJ
  • description: 50S ribosomal protein L10
  • length: 166
  • theoretical pI: 4.49215
  • theoretical MW: 17710
  • GRAVY: 0.0246988

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA aminoacylation serine--tRNA ligase (TIGR00415; EC 6.1.1.11; HMM-score: 10.8)
  • TheSEED  :
    • LSU ribosomal protein L10p (P0)
    Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L10p (P0)
  • PFAM:
    no clan defined Ribosomal_L10; Ribosomal protein L10 (PF00466; HMM-score: 110.8)
    and 1 more
    P-loop_NTPase (CL0023) AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 13.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.511
    • Cytoplasmic Membrane Score: 0.0544
    • Cell wall & surface Score: 0.0079
    • Extracellular Score: 0.4267
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00194
    • TAT(Tat/SPI): 0.000208
    • LIPO(Sec/SPII): 0.000347
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMVRRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITAEEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA1907(atpA)ATP synthase F0F1 subunit alpha  [2] (data from MRSA252)
    SA1517(citC)isocitrate dehydrogenase  [2] (data from MRSA252)
    SA1959(glmS)glucosamine--fructose-6-phosphate aminotransferase  [2] (data from MRSA252)
    SA1036(ileS)isoleucyl-tRNA synthetase  [2] (data from MRSA252)
    SA1608(metK)S-adenosylmethionine synthetase  [2] (data from MRSA252)
    SA0934(ptsH)phosphocarrier protein HPr  [2] (data from MRSA252)
    SA0498(rplL)50S ribosomal protein L7/L12  [2] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [2] (data from MRSA252)
    SA1922(rpmE2)50S ribosomal protein L31  [2] (data from MRSA252)
    SA0637hypothetical protein  [2] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: L10 leader (transcription termination) regulon
    L10 leader(RNA)important in Ribosome biogenesis; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)