Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0498 [new locus tag: SA_RS02920 ]
- pan locus tag?: SAUPAN002311000
- symbol: rplL
- pan gene symbol?: rplL
- synonym:
- product: 50S ribosomal protein L7/L12
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0498 [new locus tag: SA_RS02920 ]
- symbol: rplL
- product: 50S ribosomal protein L7/L12
- replicon: chromosome
- strand: +
- coordinates: 578254..578622
- length: 369
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123303 NCBI
- RefSeq: NP_373751 NCBI
- BioCyc: see SA_RS02920
- MicrobesOnline: 102777 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGCTAATCATGAACAAATCATTGAAGCGATTAAAGAAATGTCAGTATTAGAATTAAAC
GACTTAGTAAAAGCAATTGAAGAAGAATTTGGTGTAACTGCAGCTGCTCCAGTAGCAGTA
GCAGGTGCAGCTGGTGGCGCTGACGCTGCAGCAGAAAAAACTGAATTTGACGTTGAGTTA
ACTTCAGCTGGTTCATCTAAAATCAAAGTTGTTAAAGCTGTTAAAGAAGCAACTGGTTTA
GGATTAAAAGATGCTAAAGAATTAGTAGACGGAGCTCCTAAAGTAATCAAAGAAGCTTTA
CCTAAAGAAGAAGCTGAAAAACTTAAAGAACAATTAGAAGAAGTTGGAGCTACTGTAGAA
TTAAAATAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0498 [new locus tag: SA_RS02920 ]
- symbol: RplL
- description: 50S ribosomal protein L7/L12
- length: 122
- theoretical pI: 4.32374
- theoretical MW: 12711.5
- GRAVY: -0.0483607
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL12 (TIGR00855; HMM-score: 158.6)
- TheSEED :
- LSU ribosomal protein L7p/L12p (P1/P2)
- PFAM: no clan defined Ribosomal_L12; Ribosomal protein L7/L12 C-terminal domain (PF00542; HMM-score: 104.3)and 6 moreRibosomal_L12_N; Ribosomal protein L7/L12 dimerisation domain (PF16320; HMM-score: 75.5)DUF2267; Uncharacterized conserved protein (DUF2267) (PF10025; HMM-score: 16.3)IHF-likeDNA-bdg (CL0548) Bac_DNA_binding; Bacterial DNA-binding protein (PF00216; HMM-score: 15.7)no clan defined Ribosomal_60s; 60s Acidic ribosomal protein (PF00428; HMM-score: 15)CwsA; Cell wall synthesis protein CwsA (PF10814; HMM-score: 14.5)HTH (CL0123) HTH_33; Winged helix-turn helix (PF13592; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9475
- Cytoplasmic Membrane Score: 0.0177
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0346
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.67
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.057639
- TAT(Tat/SPI): 0.076736
- LIPO(Sec/SPII): 0.001562
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA1533 (ackA) acetate kinase [2] (data from MRSA252) SA0366 (ahpC) alkyl hydroperoxide reductase [2] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [2] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [2] (data from MRSA252) SA1234 (cspA) cold-shock protein CspA [2] (data from MRSA252) SA0471 (cysK) hypothetical protein [2] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [2] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [2] (data from MRSA252) SA0505 (fus) elongation factor G [2] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [2] (data from MRSA252) SA0375 (guaB) inositol-monophosphate dehydrogenase [2] (data from MRSA252) SA1305 (hu) DNA-binding protein II [2] (data from MRSA252) SA2068 (moeA) molybdopterin biosynthesis protein moeA [2] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [2] (data from MRSA252) SA1244 (odhB) dihydrolipoamide succinyltransferase [2] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA0944 (pdhB) pyruvate dehydrogenase E1 component subunit beta [2] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [2] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [2] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [2] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [2] (data from MRSA252) SA0728 (pgk) phosphoglycerate kinase [2] (data from MRSA252) SA1117 (pnpA) polynucleotide phosphorylase [2] (data from MRSA252) SA0935 (ptsI) phosphoenolpyruvate-protein phosphatase [2] (data from MRSA252) SA1520 (pykA) pyruvate kinase [2] (data from MRSA252) SA2341 (rocA) 1-pyrroline-5-carboxylate dehydrogenase [2] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [2] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [2] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [2] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [2] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [2] (data from MRSA252) SA2017 (rplM) 50S ribosomal protein L13 [2] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [2] (data from MRSA252) SA2032 (rplR) 50S ribosomal protein L18 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [2] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [2] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SA2030 (rpmD) 50S ribosomal protein L30 [2] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [2] (data from MRSA252) SA1308 (rpsA) 30S ribosomal protein S1 [2] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [2] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [2] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [2] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [2] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [2] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SA0503 (rpsL) 30S ribosomal protein S12 [2] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [2] (data from MRSA252) SA0708 (secA) preprotein translocase subunit SecA [2] (data from MRSA252) SA1382 (sodA) superoxide dismutase SodA [2] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [2] (data from MRSA252) SA1245 (sucA) 2-oxoglutarate dehydrogenase E1 [2] (data from MRSA252) SA1177 (tkt) transketolase [2] (data from MRSA252) SA0729 (tpiA) triosephosphate isomerase [2] (data from MRSA252) SA1100 (tsf) elongation factor Ts [2] (data from MRSA252) SA0506 (tuf) elongation factor Tu [2] (data from MRSA252) SA0295 hypothetical protein [2] (data from MRSA252) SA0641 hypothetical protein [2] (data from MRSA252) SA0802 hypothetical protein [2] (data from MRSA252) SA0829 hypothetical protein [2] (data from MRSA252) SA1528 hypothetical protein [2] (data from MRSA252) SA1532 hypothetical protein [2] (data from MRSA252) SA1599 translaldolase [2] (data from MRSA252) SA1607 hypothetical protein [2] (data from MRSA252) SA1709 hypothetical protein [2] (data from MRSA252) SA1727 hypothetical protein [2] (data from MRSA252) SA2248 hypothetical protein [2] (data from MRSA252) SA2395 L-lactate dehydrogenase [2] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [2] (data from MRSA252) SAS074 hypothetical protein [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L10 leader (transcription termination) regulon
L10 leader (RNA) important in Ribosome biogenesis; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 2.55 2.56 2.57 2.58 2.59 2.60 2.61 2.62 2.63 2.64 2.65 2.66 2.67 2.68 2.69 2.70 2.71 2.72 2.73 2.74 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)