Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0641 [new locus tag: SA_RS03665 ]
- pan locus tag?: SAUPAN002570000
- symbol: SA0641
- pan gene symbol?: mgrA
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0641 [new locus tag: SA_RS03665 ]
- symbol: SA0641
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 735417..735860
- length: 444
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123448 NCBI
- RefSeq: NP_373896 NCBI
- BioCyc: see SA_RS03665
- MicrobesOnline: 102922 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTCTGATCAACATAATTTAAAAGAACAGCTATGCTTTAGTTTGTACAATGCTCAAAGA
CAAGTTAATCGCTACTACTCTAACAAAGTTTTTAAGAAGTACAATCTAACATACCCACAA
TTTCTTGTCTTAACAATTTTATGGGATGAATCTCCTGTAAACGTCAAGAAAGTCGTAACT
GAATTAGCACTCGATACTGGTACAGTATCACCATTATTAAAACGAATGGAACAAGTAGAC
TTAATTAAGCGTGAACGTTCCGAAGTCGATCAACGTGAAGTATTTATTCACTTGACTGAC
AAAAGTGAAACTATTAGACCAGAATTAAGTAATGCATCTGACAAAGTCGCTTCAGCTTCT
TCTTTATCTCAAGATGAAGTTAAAGAACTTAATCGCTTATTAGGTAAAGTCATTCATGCA
TTTGATGAAACAAAGGAAAAATAA60
120
180
240
300
360
420
444
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0641 [new locus tag: SA_RS03665 ]
- symbol: SA0641
- description: hypothetical protein
- length: 147
- theoretical pI: 7.59928
- theoretical MW: 17089.3
- GRAVY: -0.564626
⊟Function[edit | edit source]
- TIGRFAM: mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 54.1)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 51.6)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 47.2)
- TheSEED :
- Transcriptional regulator MgrA (Regulator of autolytic activity)
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 63.8)MarR; MarR family (PF01047; HMM-score: 54.6)and 6 moreMarR_2; MarR family (PF12802; HMM-score: 34.2)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 29.5)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 26.2)PH0730-like_N; PH0730-like, N-terminal domain (PF22167; HMM-score: 18.6)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 17.8)PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 15)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.97
- Cytoplasmic Membrane Score: 0.0079
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0219
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003607
- TAT(Tat/SPI): 0.000183
- LIPO(Sec/SPII): 0.000845
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDETKEK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for NCTC8325
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)