Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0746 [new locus tag: SACOL_RS03830 ]
- pan locus tag?: SAUPAN002570000
- symbol: norR
- pan gene symbol?: mgrA
- synonym:
- product: MarR family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0746 [new locus tag: SACOL_RS03830 ]
- symbol: norR
- product: MarR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 767869..768312
- length: 444
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237855 NCBI
- RefSeq: YP_185625 NCBI
- BioCyc: see SACOL_RS03830
- MicrobesOnline: 912221 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTCTGATCAACATAATTTAAAAGAACAGCTATGCTTTAGTTTGTACAATGCTCAAAGA
CAAGTTAATCGCTACTACTCTAACAAAGTTTTTAAGAAGTACAATCTAACATACCCACAA
TTTCTTGTCTTAACAATTTTATGGGATGAATCTCCTGTAAACGTCAAGAAAGTCGTAACT
GAATTAGCACTCGATACTGGTACAGTATCACCATTATTAAAACGAATGGAACAAGTAGAC
TTAATTAAGCGTGAACGTTCCGAAGTCGATCAACGTGAAGTATTTATTCACTTGACTGAC
AAAAGTGAAACTATTAGACCAGAATTAAGTAATGCATCTGACAAAGTCGCTTCAGCTTCT
TCTTTATCGCAAGATGAAGTTAAAGAACTTAATCGCTTATTAGGTAAAGTCATTCATGCA
TTTGATGAAACAAAGGAAAAATAA60
120
180
240
300
360
420
444
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0746 [new locus tag: SACOL_RS03830 ]
- symbol: NorR
- description: MarR family transcriptional regulator
- length: 147
- theoretical pI: 7.59928
- theoretical MW: 17089.3
- GRAVY: -0.564626
⊟Function[edit | edit source]
- TIGRFAM: mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 54.1)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 51.6)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 47.2)
- TheSEED :
- Transcriptional regulator MgrA (Regulator of autolytic activity)
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 63.8)MarR; MarR family (PF01047; HMM-score: 54.6)and 6 moreMarR_2; MarR family (PF12802; HMM-score: 34.2)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 29.5)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 26.2)PH0730-like_N; PH0730-like, N-terminal domain (PF22167; HMM-score: 18.6)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 17.8)PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 15)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.97
- Cytoplasmic Membrane Score: 0.0079
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0219
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003607
- TAT(Tat/SPI): 0.000183
- LIPO(Sec/SPII): 0.000845
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDETKEK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for NCTC8325
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 14.32 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.0 6.1 6.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)