Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1234 [new locus tag: SA_RS07005 ]
- pan locus tag?: SAUPAN003817000
- symbol: cspA
- pan gene symbol?: msaB
- synonym:
- product: cold-shock protein CspA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1234 [new locus tag: SA_RS07005 ]
- symbol: cspA
- product: cold-shock protein CspA
- replicon: chromosome
- strand: -
- coordinates: 1408832..1409032
- length: 201
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124073 NCBI
- RefSeq: NP_374515 NCBI
- BioCyc: see SA_RS07005
- MicrobesOnline: 103541 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAACAAGGTACAGTTAAATGGTTTAACGCTGAAAAAGGATTCGGCTTTATCGAAGTT
GAAGGAGAAAATGACGTATTCGTACATTTTTCAGCAATTAACCAAGATGGTTACAAATCA
TTAGAAGAAGGTCAAGCTGTTGAGTTTGAAGTAGTTGAAGGCGACCGCGGTCCACAAGCT
GCAAACGTTGTTAAACTATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1234 [new locus tag: SA_RS07005 ]
- symbol: CspA
- description: cold-shock protein CspA
- length: 66
- theoretical pI: 4.22595
- theoretical MW: 7321.06
- GRAVY: -0.369697
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions cold shock domain protein CspD (TIGR02381; HMM-score: 96.5)DNA metabolism DNA replication, recombination, and repair cold shock domain protein CspD (TIGR02381; HMM-score: 96.5)and 1 moreTranscription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 10.1)
- TheSEED :
- Cold shock protein of CSP family => CspA (naming convention as in S.aureus)
- PFAM: OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 107.5)and 3 moreOB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 20.3)S1; S1 RNA binding domain (PF00575; HMM-score: 18.3)S1CSD-TOTE-2; S1/CSD-like domain 2 of the TOTE conflict systems (PF22707; HMM-score: 17.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9997
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005783
- TAT(Tat/SPI): 0.000379
- LIPO(Sec/SPII): 0.000772
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQAANVVKL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA0366 (ahpC) alkyl hydroperoxide reductase [1] (data from MRSA252) SA2428 (arcA) arginine deiminase [1] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA0471 (cysK) hypothetical protein [1] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SA0505 (fus) elongation factor G [1] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SA1305 (hu) DNA-binding protein II [1] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [1] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA1521 (pfkA) 6-phosphofructokinase [1] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA2017 (rplM) 50S ribosomal protein L13 [1] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SA0501 (rpoC) DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [1] (data from MRSA252) SA0456 (spoVG) regulatory protein SpoVG [1] (data from MRSA252) SA1499 (tig) trigger factor [1] (data from MRSA252) SA1100 (tsf) elongation factor Ts [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA0627 hypothetical protein [1] (data from MRSA252) SA1528 hypothetical protein [1] (data from MRSA252) SA1532 hypothetical protein [1] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)