From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1084 [new locus tag: SA_RS06140 ]
  • pan locus tag?: SAUPAN003530000
  • symbol: rplS
  • pan gene symbol?: rplS
  • synonym:
  • product: 50S ribosomal protein L19

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA1084 [new locus tag: SA_RS06140 ]
  • symbol: rplS
  • product: 50S ribosomal protein L19
  • replicon: chromosome
  • strand: +
  • coordinates: 1225914..1226264
  • length: 351
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACAAATCACAAATTAATCGAAGCAGTAACTAAATCACAATTGCGTACAGACTTACCA
    AGTTTCCGTCCTGGTGATACTTTACGTGTACACGTACGTATCATTGAGGGTACTCGTGAG
    CGTATCCAAGTATTCGAAGGCATTGTAATTAAACGTCGTGGCGGTGGCGTTTCTGAAACG
    TTTACAGTTCGTAAAATTTCATCAGGTGTTGGCGTGGAACGTACATTCCCATTACACACA
    CCAAAAATTGAAAAAATCGAAGTTAAACGTCGTGGTAAAGTACGTCGTGCTAAATTATAT
    TACTTACGTAGTTTACGTGGTAAAGCTGCTAGAATCCAAGAAATTCGTTAA
    60
    120
    180
    240
    300
    351


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA1084 [new locus tag: SA_RS06140 ]
  • symbol: RplS
  • description: 50S ribosomal protein L19
  • length: 116
  • theoretical pI: 12.0326
  • theoretical MW: 13375.6
  • GRAVY: -0.515517

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL19 (TIGR01024; HMM-score: 167.7)
  • TheSEED  :
    • LSU ribosomal protein L19p
    Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L19p
  • PFAM:
    SH3 (CL0010) Ribosomal_L19; Ribosomal protein L19 (PF01245; HMM-score: 175.6)
    and 1 more
    OB (CL0021) DUF7513; Domain of unknown function (DUF7513) (PF24353; HMM-score: 14.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.4396
    • Cytoplasmic Membrane Score: 0.0015
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.5588
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005435
    • TAT(Tat/SPI): 0.00106
    • LIPO(Sec/SPII): 0.000559
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGIVIKRRGGGVSETFTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA2428(arcA)arginine deiminase  [2] (data from MRSA252)
    SA1940(deoD)purine nucleoside phosphorylase  [2] (data from MRSA252)
    SA0731(eno)phosphopyruvate hydratase  [2] (data from MRSA252)
    SA0505(fus)elongation factor G  [2] (data from MRSA252)
    SA1959(glmS)glucosamine--fructose-6-phosphate aminotransferase  [2] (data from MRSA252)
    SA0245(ispD)2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase  [2] (data from MRSA252)
    SA1244(odhB)dihydrolipoamide succinyltransferase  [2] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [2] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [2] (data from MRSA252)
    SA2045(rplW)50S ribosomal protein L23  [2] (data from MRSA252)
    SA0459(rplY)50S ribosomal protein L25  [2] (data from MRSA252)
    SA0504(rpsG)30S ribosomal protein S7  [2] (data from MRSA252)
    SA2024(rpsK)30S ribosomal protein S11  [2] (data from MRSA252)
    SA1671hypothetical protein  [2] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: L19 leader (transcription termination) regulon
    L19 leader(RNA)important in Ribosome biogenesis; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)
  2. ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]