Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1151 [new locus tag: NWMN_RS06490 ]
- pan locus tag?: SAUPAN003530000
- symbol: rplS
- pan gene symbol?: rplS
- synonym:
- product: 50S ribosomal protein L19
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1151 [new locus tag: NWMN_RS06490 ]
- symbol: rplS
- product: 50S ribosomal protein L19
- replicon: chromosome
- strand: +
- coordinates: 1261498..1261848
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332558 NCBI
- RefSeq: YP_001332185 NCBI
- BioCyc:
- MicrobesOnline: 3706703 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACAAATCACAAATTAATCGAAGCAGTAACTAAATCACAATTACGTACAGACTTACCA
AGTTTCCGTCCTGGTGATACTTTACGTGTACACGTACGTATCATTGAGGGTACTCGTGAG
CGTATCCAAGTATTCGAAGGCGTTGTAATTAAACGTCGTGGCGGTGGCGTTTCTGAAACG
TTTACAGTTCGTAAAATTTCATCAGGTGTTGGCGTGGAACGTACATTCCCATTACACACA
CCAAAAATTGAAAAAATCGAAGTTAAACGTCGTGGTAAAGTACGTCGTGCTAAATTATAT
TACTTACGTAGTTTACGTGGTAAAGCTGCTAGAATCCAAGAAATTCGTTAA60
120
180
240
300
351
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: NWMN_1151 [new locus tag: NWMN_RS06490 ]
- symbol: RplS
- description: 50S ribosomal protein L19
- length: 116
- theoretical pI: 12.0326
- theoretical MW: 13361.6
- GRAVY: -0.518103
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL19 (TIGR01024; HMM-score: 168.1)
- TheSEED :
- LSU ribosomal protein L19p
- PFAM: SH3 (CL0010) Ribosomal_L19; Ribosomal protein L19 (PF01245; HMM-score: 176)and 1 moreOB (CL0021) DUF7513; Domain of unknown function (DUF7513) (PF24353; HMM-score: 15)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4347
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.5638
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005624
- TAT(Tat/SPI): 0.001152
- LIPO(Sec/SPII): 0.000585
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIKRRGGGVSETFTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_2534 (arcA) arginine deiminase [1] (data from MRSA252) NWMN_2042 (deoD) purine nucleoside phosphorylase [1] (data from MRSA252) NWMN_0745 (eno) phosphopyruvate hydratase [1] (data from MRSA252) NWMN_0509 (fus) elongation factor G [1] (data from MRSA252) NWMN_2056 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) NWMN_0189 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) NWMN_0500 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_1549 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_2150 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) NWMN_0464 (rplY) 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) NWMN_0508 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) NWMN_2127 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) NWMN_1325 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) NWMN_1746 hypothetical protein [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: rpsP > rimM > trmD > rplS
⊟Regulation[edit | edit source]
- regulator: L19 leader (transcription termination) regulon
L19 leader (RNA) important in Ribosome biogenesis; regulatory site identified based on RegPrecise data for N315 RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)