From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06490 [old locus tag: NWMN_1151 ]
  • pan locus tag?: SAUPAN003530000
  • symbol: NWMN_RS06490
  • pan gene symbol?: rplS
  • synonym:
  • product: 50S ribosomal protein L19

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS06490 [old locus tag: NWMN_1151 ]
  • symbol: NWMN_RS06490
  • product: 50S ribosomal protein L19
  • replicon: chromosome
  • strand: +
  • coordinates: 1261498..1261848
  • length: 351
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1261498..1261848) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1151

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACAAATCACAAATTAATCGAAGCAGTAACTAAATCACAATTACGTACAGACTTACCA
    AGTTTCCGTCCTGGTGATACTTTACGTGTACACGTACGTATCATTGAGGGTACTCGTGAG
    CGTATCCAAGTATTCGAAGGCGTTGTAATTAAACGTCGTGGCGGTGGCGTTTCTGAAACG
    TTTACAGTTCGTAAAATTTCATCAGGTGTTGGCGTGGAACGTACATTCCCATTACACACA
    CCAAAAATTGAAAAAATCGAAGTTAAACGTCGTGGTAAAGTACGTCGTGCTAAATTATAT
    TACTTACGTAGTTTACGTGGTAAAGCTGCTAGAATCCAAGAAATTCGTTAA
    60
    120
    180
    240
    300
    351

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: NWMN_RS06490 [old locus tag: NWMN_1151 ]
  • symbol: NWMN_RS06490
  • description: 50S ribosomal protein L19
  • length: 116
  • theoretical pI: 12.0326
  • theoretical MW: 13361.6
  • GRAVY: -0.518103

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL19 (TIGR01024; HMM-score: 168.1)
  • TheSEED: see NWMN_1151
  • PFAM:
    SH3 (CL0010) Ribosomal_L19; Ribosomal protein L19 (PF01245; HMM-score: 176)
    and 1 more
    OB (CL0021) DUF7513; Domain of unknown function (DUF7513) (PF24353; HMM-score: 15)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.4347
    • Cytoplasmic Membrane Score: 0.0015
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.5638
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005624
    • TAT(Tat/SPI): 0.001152
    • LIPO(Sec/SPII): 0.000585
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIKRRGGGVSETFTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    NWMN_RS010602-C-methyl-D-erythritol 4-phosphate cytidylyltransferase  [1] (data from MRSA252)
    NWMN_RS0265550S ribosomal protein L25/general stress protein Ctc  [1] (data from MRSA252)
    NWMN_RS0291550S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_RS0295530S ribosomal protein S7  [1] (data from MRSA252)
    NWMN_RS02960elongation factor G  [1] (data from MRSA252)
    NWMN_RS04215enolase  [1] (data from MRSA252)
    NWMN_RS07455dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS0868550S ribosomal protein L21  [1] (data from MRSA252)
    NWMN_RS09840glucosamine-6-phosphate isomerase  [1] (data from MRSA252)
    NWMN_RS11795purine-nucleoside phosphorylase  [1] (data from MRSA252)
    NWMN_RS11875glutamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    NWMN_RS1230030S ribosomal protein S11  [1] (data from MRSA252)
    NWMN_RS1241550S ribosomal protein L23  [1] (data from MRSA252)
    NWMN_RS14560arginine deiminase  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]