From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1504 [new locus tag: SA_RS08470 ]
  • pan locus tag?: SAUPAN004299000
  • symbol: infC
  • pan gene symbol?: infC
  • synonym:
  • product: translation initiation factor IF-3

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA1504 [new locus tag: SA_RS08470 ]
  • symbol: infC
  • product: translation initiation factor IF-3
  • replicon: chromosome
  • strand: -
  • coordinates: 1711348..1711866
  • length: 519
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATAGCAAAAGATCAAACTCAAATCAATGACAAAATTCGTGCAAAAGAATTACGTTTAATC
    GGTCAAGATGGTGAACAAATTGGTGTTAAATCAAAGCGTGAAGCTTTAGAAATGGCTGAA
    CGTGTAGATTTAGACTTAGTGGTCGTTGCACCGAATGCGAAACCACCAGTTGCAAGAATT
    ATGGATTACGGTAAATTCAAATTCGAACAACAGAAAAAAGAAAAAGAAATGAAAAAGAAA
    CAAAAAATTATCAATGTTAAAGAAATTCGTTTAAGTCCAACAATTGAGGAACATGATTTC
    CAAACTAAGTTGAAAAACGGACGTAAATTCTTAACTAAAGGCGATAAATGTAAAGTATCT
    ATTCGTTTCAGAGGGCGTGCCATTACGCATAAGGAAATTGGTCAACGTGTGCTAGAAAAA
    TATGCAGATGAATGCAAAGATATAGCAACAGTTGAACAAAAACCTAAAATGGACGGGCGT
    CAAATGTTTATCATGTTAGCGCCAACAGCTGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    519

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA1504 [new locus tag: SA_RS08470 ]
  • symbol: InfC
  • description: translation initiation factor IF-3
  • length: 172
  • theoretical pI: 10.4435
  • theoretical MW: 19912.3
  • GRAVY: -0.813953

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Translation factors translation initiation factor IF-3 (TIGR00168; HMM-score: 232)
  • TheSEED  :
    • Translation initiation factor 3
    Protein Metabolism Protein biosynthesis Translation initiation factors bacterial  Translation initiation factor 3
    and 1 more
    Virulence Virulence - no subcategory Mycobacterium virulence operon involved in protein synthesis (LSU ribosomal proteins)  Translation initiation factor 3
  • PFAM:
    no clan defined IF3_C; Translation initiation factor IF-3, C-terminal domain (PF00707; HMM-score: 130.5)
    IF3_N; Translation initiation factor IF-3, N-terminal domain (PF05198; HMM-score: 106)
    and 2 more
    NTP_transf (CL0260) NTP_transf_2; Nucleotidyltransferase domain (PF01909; HMM-score: 16)
    no clan defined Ntox35; Bacterial toxin 35 (PF15534; HMM-score: 11.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003275
    • TAT(Tat/SPI): 0.000542
    • LIPO(Sec/SPII): 0.000599
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPVARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKCKVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA1305(hu)DNA-binding protein II  [2] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [2] (data from MRSA252)
    SA2044(rplB)50S ribosomal protein L2  [2] (data from MRSA252)
    SA2047(rplC)50S ribosomal protein L3  [2] (data from MRSA252)
    SA2046(rplD)50S ribosomal protein L4  [2] (data from MRSA252)
    SA2033(rplF)50S ribosomal protein L6  [2] (data from MRSA252)
    SA0497(rplJ)50S ribosomal protein L10  [2] (data from MRSA252)
    SA0498(rplL)50S ribosomal protein L7/L12  [2] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [2] (data from MRSA252)
    SA2040(rplP)50S ribosomal protein L16  [2] (data from MRSA252)
    SA1084(rplS)50S ribosomal protein L19  [2] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [2] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [2] (data from MRSA252)
    SA2045(rplW)50S ribosomal protein L23  [2] (data from MRSA252)
    SA2041(rpsC)30S ribosomal protein S3  [2] (data from MRSA252)
    SAS052(rpsD)30S ribosomal protein S4  [2] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [2] (data from MRSA252)
    SA0352(rpsF)30S ribosomal protein S6  [2] (data from MRSA252)
    SA0504(rpsG)30S ribosomal protein S7  [2] (data from MRSA252)
    SA2016(rpsI)30S ribosomal protein S9  [2] (data from MRSA252)
    SA2048(rpsJ)30S ribosomal protein S10  [2] (data from MRSA252)
    SA2024(rpsK)30S ribosomal protein S11  [2] (data from MRSA252)
    SA0503(rpsL)30S ribosomal protein S12  [2] (data from MRSA252)
    SA1116(rpsO)30S ribosomal protein S15  [2] (data from MRSA252)
    SA2038(rpsQ)30S ribosomal protein S17  [2] (data from MRSA252)
    SA2043(rpsS)30S ribosomal protein S19  [2] (data from MRSA252)
    SA0295hypothetical protein  [2] (data from MRSA252)
    SA1528hypothetical protein  [2] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: L20 leader (transcription termination) regulon
    L20 leader(RNA)important in Ribosome biogenesis; RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)
  2. ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA1504&oldid=95581"