From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0466 [new locus tag: SA_RS02685 ]
  • pan locus tag?: SAUPAN002249000
  • symbol: SA0466
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0466 [new locus tag: SA_RS02685 ]
  • symbol: SA0466
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 538207..538608
  • length: 402
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCAATCGAAGTTGGAAATAAGCTTAAAGGTAAAGTCACTGGTATTAAAAAGTTTGGT
    GCATTCGTAGAATTACCTGAAGGAAAAAGTGGTTTAGTTCACATTAGTGAAGTCGCAGAT
    AATTATGTTGAAAACGTAGAAGAGCACCTTTCTGTTGGTGATGAAGTAGACGTGAAAGTA
    TTATCTATTGCTGATGATGGAAAAATTAGTCTTTCAATTAAGAAAGCTAAAGACCGTCCA
    CGTAGACAACATACGAGTAAACCAAGTCATCAAAAACCAGTGCAAAAAGCCGAAGATTTT
    GAAAAGAAATTAAGCAATTTCTTAAAAGATAGTGAAGATAAATTAACTTCAATCAAACGT
    CAAACAGAATCTAGACGCGGTGGCAAAGGTTCTAGACGTTAA
    60
    120
    180
    240
    300
    360
    402

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0466 [new locus tag: SA_RS02685 ]
  • symbol: SA0466
  • description: hypothetical protein
  • length: 133
  • theoretical pI: 10.3587
  • theoretical MW: 14811.7
  • GRAVY: -0.873684

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Transcription Degradation of RNA polyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 75.4)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS1 (TIGR00717; HMM-score: 69.5)
    and 7 more
    guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 47.4)
    Genetic information processing Transcription Degradation of RNA ribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 36.6)
    Genetic information processing Transcription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 24.2)
    Genetic information processing Transcription Degradation of RNA ribonuclease, Rne/Rng family (TIGR00757; EC 3.1.4.-; HMM-score: 18.6)
    Genetic information processing Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase (TIGR00448; EC 2.7.7.6; HMM-score: 18.3)
    Metabolism Energy metabolism Glycolysis/gluconeogenesis carbon storage regulator (TIGR00202; HMM-score: 14.2)
    Signal transduction Regulatory functions RNA interactions carbon storage regulator (TIGR00202; HMM-score: 14.2)
  • TheSEED  :
    • RNA binding protein, contains ribosomal protein S1 domain
    Cell division-ribosomal stress proteins cluster  RNA binding protein, contains ribosomal protein S1 domain
  • PFAM:
    OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 76.1)
    and 6 more
    S1_RRP5; RRP5 S1 domain (PF23459; HMM-score: 27.5)
    OB_RRP5_4th; RRP5 OB-fold domain (PF24685; HMM-score: 22.8)
    S1_2; S1 domain (PF13509; HMM-score: 16.5)
    CvfB_2nd; Virulence regulatory factor CvfB, second domain (PF21543; HMM-score: 15.4)
    no clan defined DUF3881; Domain of unknown function, E. rectale Gene description (DUF3881) (PF12997; HMM-score: 13)
    CsrA; Global regulator protein family (PF02599; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9908
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.009
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002975
    • TAT(Tat/SPI): 0.000161
    • LIPO(Sec/SPII): 0.000482
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVENVEEHLSVGDEVDVKVLSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKLSNFLKDSEDKLTSIKRQTESRRGGKGSRR

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA1520(pykA)pyruvate kinase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2044(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SA2047(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    SA2046(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    SA2035(rplE)50S ribosomal protein L5  [1] (data from MRSA252)
    SA0497(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    SA0498(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SA2040(rplP)50S ribosomal protein L16  [1] (data from MRSA252)
    SA1084(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SA2045(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    SAS052(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SA0352(rpsF)30S ribosomal protein S6  [1] (data from MRSA252)
    SA2024(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    SA1116(rpsO)30S ribosomal protein S15  [1] (data from MRSA252)
    SA2038(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    SA0627hypothetical protein  [1] (data from MRSA252)
    SA1528hypothetical protein  [1] (data from MRSA252)
    SA2123hypothetical protein  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]