⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1256 [new locus tag: SA_RS07125 ]
- pan locus tag?: SAUPAN003854000
- symbol: SA1256
- pan gene symbol?: msrB
- synonym:
- product: methionine sulfoxide reductase B
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1256 [new locus tag: SA_RS07125 ]
- symbol: SA1256
- product: methionine sulfoxide reductase B
- replicon: chromosome
- strand: -
- coordinates: 1430012..1430440
- length: 429
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124094 NCBI
- RefSeq: NP_374537 NCBI
- BioCyc: see SA_RS07125
- MicrobesOnline: 103563 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCTTAAAAAAGATAAAAGTGAACTAACAGACATAGAATATATTGTTACACAAGAAAAT
GGCACTGAACCACCATTTATGAATGAATATTGGAATCATTTTGCTAAAGGGATTTATGTA
GATAAGATTTCTGGTAAACCTTTATTTACATCTGAAGAAAAGTTTCATTCTGAATGTGGA
TGGCCTAGCTTTTCTAAAGCGCTTGATGACGATGAAATTATAGAATTAGTCGACAAATCA
TTTGGTATGGTAAGAACTGAAGTGCGTTCAGAAGAATCAAATAGTCATTTAGGACACGTC
TTTAATGATGGACCTAAAGAAAGTGGCGGCTTAAGATACTGTATCAATTCCGCTGCAATT
CAATTTATTCCATATGAAAAATTAGAAGAATTGGGTTATGGCGATTTAATATCACATTTT
GATAAGTAG60
120
180
240
300
360
420
429
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1256 [new locus tag: SA_RS07125 ]
- symbol: SA1256
- description: methionine sulfoxide reductase B
- length: 142
- theoretical pI: 4.49255
- theoretical MW: 16263
- GRAVY: -0.598592
⊟Function[edit | edit source]
- reaction: EC 1.8.4.11? ExPASyPeptide-methionine (S)-S-oxide reductase Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxinEC 1.8.4.12? ExPASyPeptide-methionine (R)-S-oxide reductase Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (R)-S-oxide + thioredoxin
- TIGRFAM: Cellular processes Adaptations to atypical conditions methionine-R-sulfoxide reductase (TIGR00357; EC 1.8.4.-; HMM-score: 192.3)Protein fate Protein modification and repair methionine-R-sulfoxide reductase (TIGR00357; EC 1.8.4.-; HMM-score: 192.3)
- TheSEED :
- Peptide-methionine (R)-S-oxide reductase MsrB (EC 1.8.4.12)
- PFAM: Beta-tent (CL0080) SelR; SelR domain (PF01641; HMM-score: 160.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9745
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0252
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017153
- TAT(Tat/SPI): 0.00034
- LIPO(Sec/SPII): 0.00047
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKKDKSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMVRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA1254 < SA1255 < SA1256 < SA1257
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)Grazyna Młynarczyk, Andrzej Młynarczyk, Ksenia Szymanek, Mirosław Luczak
[The frequency of the occurrence of genes ermA, ermB, ermC and msrA/B among methicillin-resistant Staphylococcus aureus strains resistant to erythromycin]. [Czestość wystepowania genów ermA, ermB, ermC i msrA/B u metycylino-opornych klinicznych szczepów Staphylococcus aureus opornych na erytromycyne izolowanych w Polsce.]
Med Dosw Mikrobiol: 2006, 58(3);183-90
[PubMed:17340992] [WorldCat.org] (P p)