Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1316 [new locus tag: SAUSA300_RS07170 ]
- pan locus tag?: SAUPAN003854000
- symbol: msrB
- pan gene symbol?: msrB
- synonym: JSNZ_001408
- product: methionine sulfoxide reductase B
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1316 [new locus tag: SAUSA300_RS07170 ]
- symbol: msrB
- product: methionine sulfoxide reductase B
- replicon: chromosome
- strand: -
- coordinates: 1448836..1449264
- length: 429
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914272 NCBI
- RefSeq: YP_494013 NCBI
- BioCyc: see SAUSA300_RS07170
- MicrobesOnline: 1292831 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCTTAAAAAAGATAAAAGTGAACTAACAGATATAGAATATATTGTTACACAAGAAAAC
GGCACTGAACCACCATTTATGAATGAATATTGGAATCATTTTGCTAAAGGAATTTATGTA
GATAAAATTTCTGGTAAACCTTTATTTACATCTGAAGAAAAGTTTCATTCTGAATGTGGA
TGGCCTAGCTTTTCCAAAGCGCTTGATGACGATGAAATTATAGAATTAGTCGACAAATCA
TTTGGTATGTTGAGAACTGAAGTGCGTTCAGAAGAATCAAATAGTCATTTAGGACATGTC
TTTAATGATGGACCTAAAGAAAGTGGCGGCTTAAGATACTGTATCAATTCCGCTGCAATT
CAATTTATTCCATATGAAAAGTTAGAAGAATTGGGTTATGGCGATTTAATATCACATTTT
GATAAGTAG60
120
180
240
300
360
420
429
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1316 [new locus tag: SAUSA300_RS07170 ]
- symbol: MsrB
- description: methionine sulfoxide reductase B
- length: 142
- theoretical pI: 4.49255
- theoretical MW: 16277.1
- GRAVY: -0.601408
⊟Function[edit | edit source]
- reaction: EC 1.8.4.11? ExPASyPeptide-methionine (S)-S-oxide reductase Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxinEC 1.8.4.12? ExPASyPeptide-methionine (R)-S-oxide reductase Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (R)-S-oxide + thioredoxin
- TIGRFAM: Cellular processes Adaptations to atypical conditions methionine-R-sulfoxide reductase (TIGR00357; EC 1.8.4.-; HMM-score: 191.5)Protein fate Protein modification and repair methionine-R-sulfoxide reductase (TIGR00357; EC 1.8.4.-; HMM-score: 191.5)
- TheSEED :
- Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)
- PFAM: Beta-tent (CL0080) SelR; SelR domain (PF01641; HMM-score: 159)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9752
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0244
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017153
- TAT(Tat/SPI): 0.00034
- LIPO(Sec/SPII): 0.00047
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKKDKSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMLRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAUSA300_1314 < crr < msrB < msrA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
During oxidative conditions, such as those experienced within a macrophage, methionine residues in proteins may be oxidized to methionine sulfoxide. Peptide-methionine-(R)-sulfoxide reductase B (MsrB) specifically reduces the (R) epimer of methionine sulfoxide to methionine. Peptide-methionine-(S)-sulfoxide reductase A (MsrA1) catalyzes the analogous reduction for the (S) epimer. S. aureus produces three isoforms of MsrA but only MsrA1 is thought to contribute meaningful reduction of (S)-sulfoxides. While MsrA2 and MsrA3 are catalytically active, they are transcribed at such low levels that they do not make a meaningful contribution under oxidative conditions.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
- ↑ Vineet K Singh, Manisha Vaish, Trintje R Johansson, Kyle R Baum, Robert P Ring, Saumya Singh, Sanjay K Shukla, Jackob Moskovitz
Significance of four methionine sulfoxide reductases in Staphylococcus aureus.
PLoS One: 2015, 10(2);e0117594
[PubMed:25680075] [WorldCat.org] [DOI] (I e)