From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1254 [new locus tag: SA_RS07115 ]
  • pan locus tag?: SAUPAN003852000
  • symbol: SA1254
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA1254 [new locus tag: SA_RS07115 ]
  • symbol: SA1254
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1429279..1429500
  • length: 222
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAAAACTATTCGTTTTATCAATTTGTCATGACAGTTCGTGGTCGACACGACGATAAA
    GGTCGTCTAGCAGAAGAGATATTTGACGATCTTGCTTTCCCAAAACACGATGATGATTTT
    AACATACTGTCTGATTATATTGAGACACATGGTGATTTCACATTGCCAATGTCTGTATTT
    GATGATTTATATGAAGAATATACGGAATGGCTAAAATTTTAA
    60
    120
    180
    222

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA1254 [new locus tag: SA_RS07115 ]
  • symbol: SA1254
  • description: hypothetical protein
  • length: 73
  • theoretical pI: 4.14928
  • theoretical MW: 8869.76
  • GRAVY: -0.617808

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • UPF0346 protein YozE
  • PFAM:
    no clan defined YozE_SAM_like; YozE SAM-like fold (PF06855; HMM-score: 82.5)
    and 2 more
    P-loop_NTPase (CL0023) Terminase_6; Terminase-like family (PF03237; HMM-score: 13.9)
    no clan defined HA; Helicase associated domain (PF03457; HMM-score: 12.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011149
    • TAT(Tat/SPI): 0.000218
    • LIPO(Sec/SPII): 0.001612
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKF

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA1254&oldid=95107"