From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1456 [new locus tag: SACOL_RS07435 ]
  • pan locus tag?: SAUPAN003852000
  • symbol: SACOL1456
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1456 [new locus tag: SACOL_RS07435 ]
  • symbol: SACOL1456
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1471159..1471380
  • length: 222
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAAAACTATTCGTTTTATCAATTTGTCATGACAGTTCGTGGTCGACACGACGATAAA
    GGTCGTCTAGCAGAAGAGATATTTGACGATCTTGCTTTCCCAAAACACGATGATGATTTT
    AACATACTGTCTGATTATATTGAGACACATGGTGATTTCACATTGCCAATGTCTGTATTT
    GATGATTTATATGAAGAATATACGGAATGGCTAAAATTTTAA
    60
    120
    180
    222

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1456 [new locus tag: SACOL_RS07435 ]
  • symbol: SACOL1456
  • description: hypothetical protein
  • length: 73
  • theoretical pI: 4.14928
  • theoretical MW: 8869.76
  • GRAVY: -0.617808

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • UPF0346 protein YozE
  • PFAM:
    no clan defined YozE_SAM_like; YozE SAM-like fold (PF06855; HMM-score: 80.7)
    and 1 more
    P-loop_NTPase (CL0023) Terminase_6N; Terminase large subunit, T4likevirus-type, N-terminal (PF03237; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7875
    • Cytoplasmic Membrane Score: 0.0068
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.2057
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011149
    • TAT(Tat/SPI): 0.000218
    • LIPO(Sec/SPII): 0.001612
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKF

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: 168 [1]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: VraR (activation) regulon
    VraR(TF)response regulator important for resistance against cell-wall targeting antibiotics;  [2] [3]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  2. ↑ Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
    Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
    Mol Microbiol: 2003, 49(3);807-21
    [PubMed:12864861] [WorldCat.org] [DOI] (P p)
  3. ↑ Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
    VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
    Antimicrob Agents Chemother: 2013, 57(1);83-95
    [PubMed:23070169] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1456&oldid=78530"