From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0873 [new locus tag: SA_RS04935 ]
  • pan locus tag?: SAUPAN003192000
  • symbol: SA0873
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA0873 [new locus tag: SA_RS04935 ]
  • symbol: SA0873
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 989093..989602
  • length: 510
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTTTAGGATTAGCATTAATTCCATCAAAGTCATTTCAAGAAGCGGTGGATTCTTAC
    CGTAAAAGATATGATAAACAGTATTCACGAATTAAACCACATGTGACAATTAAAGCGCCA
    TTTGAAATTGAAGATGGTGATTTAGATTCTGTCATTGAACAGGTTAGAGCTCGTATTAAT
    GGTATACCAGCAGTAGAAGTTCATGCTACAAAAGCTTCTAGCTTCAAACCAACGAACAAT
    GTGATTTACTTTAAAGTTGCGAAGACGGACGACTTAGAAGAATTGTTTAATCGCTTTAAT
    GGAGAAGATTTCTATGGAGAAGCTGAACATGTTTTTGTGCCACACTTTACAATAGCACAA
    GGACTATCTAGCCAAGAATTCGAAGATATTTTTGGTCAAGTAGCATTAGCTGGGGTAGAC
    CATAAAGAAATTATCGATGAATTAACTTTGTTACGTTTTGACGATGACGAAGATAAATGG
    AAAGTTATTGAAACGTTTAAATTAGCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    510


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA0873 [new locus tag: SA_RS04935 ]
  • symbol: SA0873
  • description: hypothetical protein
  • length: 169
  • theoretical pI: 4.63165
  • theoretical MW: 19326.6
  • GRAVY: -0.311243

⊟Function[edit | edit source]

  • reaction:
    EC 3.1.-.-?  ExPASy
  • TIGRFAM:
    Genetic information processing Transcription RNA processing 2'-5' RNA ligase (TIGR02258; EC 6.5.1.-; HMM-score: 15.9)
    and 1 more
    putative phosphonate metabolism protein (TIGR03223; HMM-score: 12.2)
  • TheSEED  :
    • 2H phosphoesterase superfamily protein Bsu1186 (yjcG)
    RNA Metabolism RNA processing and modification RNA processing orphans  2H phosphoesterase superfamily protein Bsu1186 (yjcG)
  • PFAM:
    2H (CL0247) 2_5_RNA_ligase2; 2'-5' RNA ligase superfamily (PF13563; HMM-score: 78.8)
    and 5 more
    LigT_PEase; LigT like Phosphoesterase (PF02834; HMM-score: 48.5)
    CPDase; Cyclic phosphodiesterase-like protein (PF07823; HMM-score: 18.7)
    no clan defined DUF6707; Family of unknown function (DUF6707) (PF20453; HMM-score: 13.8)
    E-set (CL0159) TarS_C1; TarS beta-glycosyltransferase C-terminal domain 1 (PF18674; HMM-score: 13.3)
    TPR (CL0020) Vps16_C; Vps16, C-terminal region (PF04840; HMM-score: 12.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9836
    • Cytoplasmic Membrane Score: 0.0087
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0075
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.83
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012487
    • TAT(Tat/SPI): 0.000962
    • LIPO(Sec/SPII): 0.001343
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIEDGDLDSVIEQVRARINGIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQGLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA1984(asp23)alkaline shock protein 23  [1] (data from MRSA252)
    SA0727(gap)glyceraldehyde-3-phosphate dehydrogenase  [1] (data from MRSA252)
    SA1244(odhB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    SA0943-1(pdhA)pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA0945(pdhC)branched-chain alpha-keto acid dehydrogenase E2 subunit  [1] (data from MRSA252)
    SA0946(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SA1520(pykA)pyruvate kinase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA1084(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SA2038(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA0760glycine cleavage system protein H  [1] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: CcpA regulon
    CcpA(TF)important in Carbon catabolism; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)