From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1831 [new locus tag: SACOL_RS09385 ]
  • pan locus tag?: SAUPAN004479000
  • symbol: tal
  • pan gene symbol?: tal
  • synonym:
  • product: translaldolase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1831 [new locus tag: SACOL_RS09385 ]
  • symbol: tal
  • product: translaldolase
  • replicon: chromosome
  • strand: -
  • coordinates: 1885160..1885873
  • length: 714
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAAACTAAATGTAGAAGTATTTGCGGACGGTGCAGATATTGAAGAAATGAAAGCA
    GCTTATAAAAACAAACAAGTGGATGGTTTTACAACAAATCCTAGTTTAATGGCTAAAGCG
    GGCGTAACAGATTACAAAGCTTTTGCTGAAGAAGCTGTGAAAGAAATTCCAGATGCTTCA
    ATTTCATTTGAAGTATTTGCAGACGATTTAGAAACTATGGAAAAAGAAGCAGCAATTTTA
    AAACAATATGGCGAAAATGTATTTGTTAAAATTCCTATTGTAAATACAAAAGGTGAATCA
    ACGATTCCTTTAATTAAAAAACTTTCAGCTGACAATGTGAGATTAAACGTTACGGCTGTT
    TACACAATTGAACAAGTTAAAGAAATAACTGAAGCAGTAACTGAAGGTGTGCCAACATAT
    GTTTCAGTATTTGCAGGACGTATTGCAGATACAGGCGTAGATCCATTACCATTAATGAAA
    GAGGCTGTAAAAGTTACGCATAGTAAAGACGGCGTTAAATTATTATGGGCAAGTTGCCGC
    GAATTATTCAATGTGATTCAAGCTGATGAAATTGGTGCAGATATTATTACATGCCCAGCA
    GATGTTGTGAAAAAAGTGAATACAAACTTAGGTCGCGATATTAACGAATTATCAGTAGAT
    ACAGTTAAAGGCTTTGCGAAAGATATTCAATCTTCAGGTCTTTCTATTCTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1831 [new locus tag: SACOL_RS09385 ]
  • symbol: Tal
  • description: translaldolase
  • length: 237
  • theoretical pI: 4.45164
  • theoretical MW: 25705.3
  • GRAVY: 0.00506329

Function[edit | edit source]

  • reaction:
    EC 2.2.1.2?  ExPASy
    Transaldolase Sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-erythrose 4-phosphate + D-fructose 6-phosphate
  • TIGRFAM:
    Metabolism Energy metabolism Pentose phosphate pathway transaldolase (TIGR02134; EC 2.2.1.2; HMM-score: 443.3)
    and 3 more
    Metabolism Energy metabolism Pentose phosphate pathway fructose-6-phosphate aldolase (TIGR00875; EC 4.1.2.-; HMM-score: 102)
    Metabolism Energy metabolism Pentose phosphate pathway transaldolase (TIGR00874; EC 2.2.1.2; HMM-score: 24.3)
    Metabolism Energy metabolism Pentose phosphate pathway transaldolase (TIGR00876; EC 2.2.1.2; HMM-score: 22.2)
  • TheSEED  :
    • Transaldolase (EC 2.2.1.2)
    Carbohydrates Central carbohydrate metabolism Pentose phosphate pathway  Transaldolase (EC 2.2.1.2)
    and 1 more
    Carbohydrates Monosaccharides Fructose utilization  Transaldolase (EC 2.2.1.2)
  • PFAM:
    TIM_barrel (CL0036) TAL_FSA; Transaldolase/Fructose-6-phosphate aldolase (PF00923; HMM-score: 146.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9213
    • Cytoplasmic Membrane Score: 0.0022
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0764
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004292
    • TAT(Tat/SPI): 0.000536
    • LIPO(Sec/SPII): 0.000716
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAKLNVEVFADGADIEEMKAAYKNKQVDGFTTNPSLMAKAGVTDYKAFAEEAVKEIPDASISFEVFADDLETMEKEAAILKQYGENVFVKIPIVNTKGESTIPLIKKLSADNVRLNVTAVYTIEQVKEITEAVTEGVPTYVSVFAGRIADTGVDPLPLMKEAVKVTHSKDGVKLLWASCRELFNVIQADEIGADIITCPADVVKKVNTNLGRDINELSVDTVKGFAKDIQSSGLSIL

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 3824 [5]
  • interaction partners:
    SACOL1102(pdhA)pyruvate dehydrogenase complex E1 component subunit alpha  [6] (data from MRSA252)
    SACOL1104(pdhC)branched-chain alpha-keto acid dehydrogenase E2  [6] (data from MRSA252)
    SACOL1105(pdhD)dihydrolipoamide dehydrogenase  [6] (data from MRSA252)
    SACOL0585(rplJ)50S ribosomal protein L10  [6] (data from MRSA252)
    SACOL1257(rplS)50S ribosomal protein L19  [6] (data from MRSA252)
    SACOL1702(rplU)50S ribosomal protein L21  [6] (data from MRSA252)
    SACOL2233(rpsC)30S ribosomal protein S3  [6] (data from MRSA252)
    SACOL2214(rpsK)30S ribosomal protein S11  [6] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 33.98 h [7]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. 6.0 6.1 6.2 6.3 6.4 6.5 6.6 6.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  7. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]