Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2207 [new locus tag: SACOL_RS11620 ]
- pan locus tag?: SAUPAN005667000
- symbol: rplM
- pan gene symbol?: rplM
- synonym:
- product: 50S ribosomal protein L13
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2207 [new locus tag: SACOL_RS11620 ]
- symbol: rplM
- product: 50S ribosomal protein L13
- replicon: chromosome
- strand: -
- coordinates: 2289086..2289523
- length: 438
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237137 NCBI
- RefSeq: YP_187017 NCBI
- BioCyc: see SACOL_RS11620
- MicrobesOnline: 913692 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCGTCAAACATTTATGGCAAATGAATCAAACATTGAGCGCAAATGGTATGTTATCGAT
GCTGAAGGCCAAACATTAGGTCGTTTATCATCAGAAGTAGCATCTATCTTACGCGGTAAA
AATAAAGTAACTTACACACCACACGTTGATACTGGTGATTATGTAATCGTTATTAATGCA
TCAAAAATCGAATTTACTGGTAACAAAGAAACTGACAAAGTTTACTACCGTCACTCAAAT
CACCCAGGTGGTATCAAATCAATCACTGCTGGTGAATTAAGAAGAACTAACCCAGAACGT
TTAATTGAAAACTCAATTAAAGGTATGTTACCAAGCACTCGTTTAGGCGAAAAACAAGGT
AAAAAATTATTTGTATATGGTGGCGCTGAACATCCACACGCTGCACAACAACCAGAAAAC
TACGAATTACGTGGTTAA60
120
180
240
300
360
420
438
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SACOL2207 [new locus tag: SACOL_RS11620 ]
- symbol: RplM
- description: 50S ribosomal protein L13
- length: 145
- theoretical pI: 9.74811
- theoretical MW: 16333.3
- GRAVY: -0.762069
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL13 (TIGR01066; HMM-score: 201.9)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL13 (TIGR01077; HMM-score: 49.1)
- TheSEED :
- LSU ribosomal protein L13p (L13Ae)
- PFAM: no clan defined Ribosomal_L13; Ribosomal protein L13 (PF00572; HMM-score: 153.8)and 1 moreTrefoil (CL0066) Beta-tre_PLH30; Endo-acting ulvan lyase beta-trefoil domain (PF24208; HMM-score: 14.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.3965
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.6034
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009239
- TAT(Tat/SPI): 0.000698
- LIPO(Sec/SPII): 0.001378
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELRG
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4] [5]
- quantitative data / protein copy number per cell: 3735 [6]
- interaction partners:
SACOL1760 (ackA) acetate kinase [7] (data from MRSA252) SACOL1247 (acpP) acyl carrier protein [7] (data from MRSA252) SACOL0660 (adhP) alcohol dehydrogenase [7] (data from MRSA252) SACOL0452 (ahpC) alkyl hydroperoxide reductase subunit C [7] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [7] (data from MRSA252) SACOL2656 (arcB2) ornithine carbamoyltransferase [7] (data from MRSA252) SACOL1494 (asnC) asparaginyl-tRNA synthetase [7] (data from MRSA252) SACOL0833 (clpP) ATP-dependent Clp protease proteolytic subunit [7] (data from MRSA252) SACOL0557 (cysK) cysteine synthase [7] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [7] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [7] (data from MRSA252) SACOL0634 (eutD) phosphotransacetylase [7] (data from MRSA252) SACOL1245 (fabG1) 3-oxoacyl-ACP reductase [7] (data from MRSA252) SACOL1016 (fabI) enoyl-ACP reductase [7] (data from MRSA252) SACOL2091 (fabZ) (3R)-hydroxymyristoyl-ACP dehydratase [7] (data from MRSA252) SACOL2117 (fbaA) fructose-bisphosphate aldolase [7] (data from MRSA252) SACOL2622 (fdaB) fructose-1,6-bisphosphate aldolase [7] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [7] (data from MRSA252) SACOL1072 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [7] (data from MRSA252) SACOL1278 (frr) ribosome recycling factor [7] (data from MRSA252) SACOL1199 (ftsZ) cell division protein FtsZ [7] (data from MRSA252) SACOL0593 (fusA) elongation factor G [7] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [7] (data from MRSA252) SACOL1960 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [7] (data from MRSA252) SACOL1622 (glyS) glycyl-tRNA synthetase [7] (data from MRSA252) SACOL1554 (gnd) 6-phosphogluconate dehydrogenase [7] (data from MRSA252) SACOL2017 (groES) co-chaperonin GroES [7] (data from MRSA252) SACOL1638 (grpE) heat shock protein GrpE [7] (data from MRSA252) SACOL0460 (guaB) inosine-5'-monophosphate dehydrogenase [7] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [7] (data from MRSA252) SACOL1288 (infB) translation initiation factor IF-2 [7] (data from MRSA252) SACOL2618 (ldh2) L-lactate dehydrogenase [7] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [7] (data from MRSA252) SACOL2116 (murAB) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [7] (data from MRSA252) SACOL0746 (norR) MarR family transcriptional regulator [7] (data from MRSA252) SACOL1285 (nusA) transcription elongation factor NusA [7] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [7] (data from MRSA252) SACOL1103 (pdhB) pyruvate dehydrogenase complex E1 component subunit beta [7] (data from MRSA252) SACOL1104 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 [7] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [7] (data from MRSA252) SACOL1005 (pepF) oligoendopeptidase F [7] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [7] (data from MRSA252) SACOL0966 (pgi) glucose-6-phosphate isomerase [7] (data from MRSA252) SACOL0839 (pgk) phosphoglycerate kinase [7] (data from MRSA252) SACOL1293 (pnp) polynucleotide phosphorylase/polyadenylase [7] (data from MRSA252) SACOL1282 (proS) prolyl-tRNA synthetase [7] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [7] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [7] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [7] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [7] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [7] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [7] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [7] (data from MRSA252) SACOL0015 (rplI) 50S ribosomal protein L9 [7] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [7] (data from MRSA252) SACOL0583 (rplK) 50S ribosomal protein L11 [7] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [7] (data from MRSA252) SACOL2229 (rplN) 50S ribosomal protein L14 [7] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [7] (data from MRSA252) SACOL2212 (rplQ) 50S ribosomal protein L17 [7] (data from MRSA252) SACOL2223 (rplR) 50S ribosomal protein L18 [7] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [7] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [7] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [7] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [7] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [7] (data from MRSA252) SACOL2228 (rplX) 50S ribosomal protein L24 [7] (data from MRSA252) SACOL0545 (rplY) 50S ribosomal protein L25/general stress protein Ctc [7] (data from MRSA252) SACOL1238 (rpmB) 50S ribosomal protein L28 [7] (data from MRSA252) SACOL2221 (rpmD) 50S ribosomal protein L30 [7] (data from MRSA252) SACOL2112 (rpmE2) 50S ribosomal protein L31 [7] (data from MRSA252) SACOL1726 (rpmI) 50S ribosomal protein L35 [7] (data from MRSA252) SACOL0588 (rpoB) DNA-directed RNA polymerase subunit beta [7] (data from MRSA252) SACOL1516 (rpsA) 30S ribosomal protein S1 [7] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [7] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [7] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [7] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [7] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [7] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [7] (data from MRSA252) SACOL2225 (rpsH) 30S ribosomal protein S8 [7] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [7] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [7] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [7] (data from MRSA252) SACOL0591 (rpsL) 30S ribosomal protein S12 [7] (data from MRSA252) SACOL2215 (rpsM) 30S ribosomal protein S13 [7] (data from MRSA252) SACOL1292 (rpsO) 30S ribosomal protein S15 [7] (data from MRSA252) SACOL1254 (rpsP) 30S ribosomal protein S16 [7] (data from MRSA252) SACOL0439 (rpsR) 30S ribosomal protein S18 [7] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [7] (data from MRSA252) SACOL1642 (rpsT) 30S ribosomal protein S20 [7] (data from MRSA252) SACOL1610 (sodA2) superoxide dismutase [7] (data from MRSA252) SACOL0095 (spa) immunoglobulin G binding protein A precursor [7] (data from MRSA252) SACOL0541 (spoVG) regulatory protein SpoVG [7] (data from MRSA252) SACOL1449 (sucA) 2-oxoglutarate dehydrogenase E1 component [7] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [7] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [7] (data from MRSA252) SACOL1263 (sucD) succinyl-CoA synthetase subunit alpha [7] (data from MRSA252) SACOL0626 (thiD1) phosphomethylpyrimidine kinase [7] (data from MRSA252) SACOL1377 (tkt) transketolase [7] (data from MRSA252) SACOL0840 (tpiA) triosephosphate isomerase [7] (data from MRSA252) SACOL1155 (trxA) thioredoxin [7] (data from MRSA252) SACOL1276 (tsf) elongation factor Ts [7] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [7] (data from MRSA252) SACOL0435 GTP-dependent nucleic acid-binding protein EngD [7] (data from MRSA252) SACOL0457 hypothetical protein [7] (data from MRSA252) SACOL0552 hypothetical protein [7] (data from MRSA252) SACOL0564 pyridoxal biosynthesis lyase PdxS [7] (data from MRSA252) SACOL0688 ABC transporter substrate-binding protein [7] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [7] (data from MRSA252) SACOL0815 ribosomal subunit interface protein [7] (data from MRSA252) SACOL0875 thioredoxin [7] (data from MRSA252) SACOL0944 NADH dehydrogenase [7] (data from MRSA252) SACOL1020 hypothetical protein [7] (data from MRSA252) SACOL1457 PTS system, IIA component [7] (data from MRSA252) SACOL1670 hypothetical protein [7] (data from MRSA252) SACOL1753 universal stress protein [7] (data from MRSA252) SACOL1933 ThiJ/PfpI family protein [7] (data from MRSA252) SACOL1952 ferritins family protein [7] (data from MRSA252) SACOL2114 aldehyde dehydrogenase [7] (data from MRSA252) SACOL2163 hypothetical protein [7] (data from MRSA252) SACOL2173 alkaline shock protein 23 [7] (data from MRSA252) SACOL2569 1-pyrroline-5-carboxylate dehydrogenase [7] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L13 leader (transcription termination) regulon
L13 leader (RNA) important in Ribosome biogenesis; regulatory site identified based on RegPrecise data for N315 RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 12.82 h [8]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
Profiling the surfacome of Staphylococcus aureus.
Proteomics: 2010, 10(17);3082-96
[PubMed:20662103] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 7.000 7.001 7.002 7.003 7.004 7.005 7.006 7.007 7.008 7.009 7.010 7.011 7.012 7.013 7.014 7.015 7.016 7.017 7.018 7.019 7.020 7.021 7.022 7.023 7.024 7.025 7.026 7.027 7.028 7.029 7.030 7.031 7.032 7.033 7.034 7.035 7.036 7.037 7.038 7.039 7.040 7.041 7.042 7.043 7.044 7.045 7.046 7.047 7.048 7.049 7.050 7.051 7.052 7.053 7.054 7.055 7.056 7.057 7.058 7.059 7.060 7.061 7.062 7.063 7.064 7.065 7.066 7.067 7.068 7.069 7.070 7.071 7.072 7.073 7.074 7.075 7.076 7.077 7.078 7.079 7.080 7.081 7.082 7.083 7.084 7.085 7.086 7.087 7.088 7.089 7.090 7.091 7.092 7.093 7.094 7.095 7.096 7.097 7.098 7.099 7.100 7.101 7.102 7.103 7.104 7.105 7.106 7.107 7.108 7.109 7.110 7.111 7.112 7.113 7.114 7.115 7.116 7.117 7.118 7.119 7.120 7.121 7.122 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)