From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1933 [new locus tag: SACOL_RS10110 ]
  • symbol: SACOL1933
  • product: ThiJ/PfpI family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1997916..1998431
  • length: 516
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGACTAAAAAAGTAGCAATTATTCTAGCAAACGAATTTGAAGATATAGAATATTCAAGC
    CCTAAAGAGGCATTAGAGAATGCAGGCTTTAATACTGTAGTGATTGGAGATACTGCAAAT
    AGTGAAGTTGTTGGTAAACACGGTGAAAAAGTTACTGTCGATGTAGGCATTGCAGAAGCT
    AAACCAGAAGATTATGATGCATTATTAATTCCTGGAGGATTTTCACCAGATCATTTACGT
    GGAGATACAGAAGGTCGATATGGCACATTTGCTAAATACTTTACTAAAAATGATGTACCA
    ACATTTGCCATTTGTCATGGGCCACAAATACTAATAGATACAGACGATTTAAAAGGTCGT
    ACGTTAACAGCAGTATTAAATGTACGCAAAGATTTATCAAATGCAGGCGCACATGTAGTT
    GATGAGTCAGTAGTTGTAGACAACAATATTGTAACAAGTCGAGTACCAGACGATTTAGAT
    GATTTTAATCGAGAAATCGTTAAACAATTACAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    516

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1933 [new locus tag: SACOL_RS10110 ]
  • symbol: SACOL1933
  • description: ThiJ/PfpI family protein
  • length: 171
  • theoretical pI: 4.36059
  • theoretical MW: 18631.7
  • GRAVY: -0.27193

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides intracellular protease, PfpI family (TIGR01382; HMM-score: 156.9)
    and 4 more
    Unknown function General DJ-1 family protein (TIGR01383; HMM-score: 62.4)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 25.1)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis CTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 20.8)
    Metabolism Amino acid biosynthesis Histidine family imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 13.6)
  • TheSEED  :
    • Intracellular protease
    CBSS-176280.1.peg.1561  ThiJ/PfpI family protein
  • PFAM:
    Glutaminase_I (CL0014) DJ-1_PfpI; DJ-1/PfpI family (PF01965; HMM-score: 184.3)
    and 4 more
    GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 22.7)
    GATase_5; CobB/CobQ-like glutamine amidotransferase domain (PF13507; HMM-score: 15.9)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 15.1)
    Catalase_C; C-terminal domain found in long catalases (PF18011; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9632
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0009
    • Extracellular Score: 0.0355
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010579
    • TAT(Tat/SPI): 0.000386
    • LIPO(Sec/SPII): 0.000992
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAICHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQ

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 2892 [5]
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 37.36 h [7]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  7. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]