From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1490 [new locus tag: SAUSA300_RS08135 ]
  • pan locus tag?: SAUPAN004106000
  • symbol: efp
  • pan gene symbol?: efp
  • synonym:
  • product: elongation factor P

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1490 [new locus tag: SAUSA300_RS08135 ]
  • symbol: efp
  • product: elongation factor P
  • replicon: chromosome
  • strand: -
  • coordinates: 1644418..1644975
  • length: 558
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTTCGGTTAATGATTTTAAAACAGGTTTAACAATTTCTGTTGATAACGCTATTTGG
    AAAGTTATAGACTTCCAACATGTAAAGCCTGGTAAAGGTTCAGCATTCGTTCGTTCAAAA
    TTACGTAATTTAAGAACTGGTGCAATTCAAGAGAAAACGTTTAGAGCTGGTGAAAAAGTT
    GAACCAGCAATGATTGAAAATCGTCGCATGCAATATTTATATGCTGACGGAGATAATCAT
    GTATTTATGGATAATGAAAGCTTTGAACAAACAGAACTTTCAAGTGATTACTTAAAAGAA
    GAATTGAATTACTTAAAAGAAGGTATGGAAGTACAAATTCAAACATACGAAGGTGAAACT
    ATCGGTGTTGAATTACCTAAAACTGTTGAATTAACAGTAACTGAAACAGAACCTGGTATT
    AAAGGTGATACTGCAACTGGTGCCACTAAATCGGCAACTGTTGAAACTGGTTATACATTA
    AATGTACCTTTATTTGTAAACGAAGGTGACGTTTTAATTATCAACACTGGTGATGGAAGC
    TACATTTCAAGAGGATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    558

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_1490 [new locus tag: SAUSA300_RS08135 ]
  • symbol: Efp
  • description: elongation factor P
  • length: 185
  • theoretical pI: 4.46265
  • theoretical MW: 20553.9
  • GRAVY: -0.41027

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Translation factors translation elongation factor P (TIGR00038; HMM-score: 265.8)
    and 2 more
    Genetic information processing Protein synthesis Translation factors elongation factor P-like protein YeiP (TIGR02178; HMM-score: 127.2)
    Genetic information processing Protein synthesis Translation factors translation elongation factor IF5A (TIGR00037; HMM-score: 22.7)
  • TheSEED  :
    • Translation elongation factor P
    Protein Metabolism Protein biosynthesis Translation elongation factors bacterial  Translation elongation factor P
  • PFAM:
    KOW (CL0107) EFP_N; Elongation factor P (EF-P) KOW-like domain (PF08207; HMM-score: 96.5)
    OB (CL0021) Elong-fact-P_C; Elongation factor P, C-terminal (PF09285; HMM-score: 90.7)
    EFP; Elongation factor P (EF-P) OB domain (PF01132; HMM-score: 82.6)
    and 1 more
    no clan defined SMC_Nse1; Nse1 non-SMC component of SMC5-6 complex (PF07574; HMM-score: 15)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002655
    • TAT(Tat/SPI): 0.000227
    • LIPO(Sec/SPII): 0.00036
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGSYISRG

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 1.138 1.139 1.140 1.141 1.142 1.143 1.144 1.145 1.146 1.147 1.148 1.149 1.150 1.151 1.152 1.153 1.154 1.155 1.156 1.157 1.158 1.159 1.160 1.161 1.162 1.163 1.164 1.165 1.166 1.167 1.168 1.169 1.170 1.171 1.172 1.173 1.174 1.175 1.176 1.177 1.178 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAUSA300_1490&oldid=57471"