From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS02815 [old locus tag: SACOL0550 ]
  • symbol: SACOL_RS02815
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 560264..560527
  • length: 264
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (560264..560527) NCBI
  • BioCyc: SACOL_RS02815 BioCyc
  • MicrobesOnline: see SACOL0550

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGATTAGATAAATATTTAAAAGTATCACGGTTAATAAAGCGACGTACGCTAGCAAAA
    GAAGTAAGTGATCAAGGTAGAATTACAATAAATGGTAATGTTGCTAAAGCTGGATCGGAT
    GTTAAAGTTGAAGATGTGCTGACGATTCGCTTTGGTCAAAAATTAGTAACAGTTAAAGTA
    ACTGCATTAAATGAACATGCATCTAAAGATAACGCGAAGGGTATGTATGAAATCATTGAA
    GAGCGTCGACTTGAAGAAGCGTAA
    60
    120
    180
    240
    264

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS02815 [old locus tag: SACOL0550 ]
  • symbol: SACOL_RS02815
  • description: hypothetical protein
  • length: 87
  • theoretical pI: 10.3609
  • theoretical MW: 9856.36
  • GRAVY: -0.478161

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL0550
  • PFAM:
    S4 (CL0492) S4; S4 domain (PF01479; HMM-score: 37.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9987
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0011
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009238
    • TAT(Tat/SPI): 0.001471
    • LIPO(Sec/SPII): 0.001435
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVEDVLTIRFGQKLVTVKVTALNEHASKDNAKGMYEIIEERRLEEA

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Jump up to: 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 1.138 1.139 1.140 1.141 1.142 1.143 1.144 1.145 1.146 1.147 1.148 1.149 1.150 1.151 1.152 1.153 1.154 1.155 1.156 1.157 1.158 1.159 1.160 1.161 1.162 1.163 1.164 1.165 1.166 1.167 1.168 1.169 1.170 1.171 1.172 1.173 1.174 1.175 1.176 1.177 1.178 1.179 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02815 [old locus tag: SACOL0550 ]
  • pan locus tag?: SAUPAN002247000
  • symbol: SACOL_RS02815
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS02815 [old locus tag: SACOL0550 ]
  • symbol: SACOL_RS02815
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 560264..560527
  • length: 264
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (560264..560527) NCBI
  • BioCyc: SACOL_RS02815 BioCyc
  • MicrobesOnline: see SACOL0550

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGATTAGATAAATATTTAAAAGTATCACGGTTAATAAAGCGACGTACGCTAGCAAAA
    GAAGTAAGTGATCAAGGTAGAATTACAATAAATGGTAATGTTGCTAAAGCTGGATCGGAT
    GTTAAAGTTGAAGATGTGCTGACGATTCGCTTTGGTCAAAAATTAGTAACAGTTAAAGTA
    ACTGCATTAAATGAACATGCATCTAAAGATAACGCGAAGGGTATGTATGAAATCATTGAA
    GAGCGTCGACTTGAAGAAGCGTAA
    60
    120
    180
    240
    264

This data comes from external databases and cannot be edited.

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS02815 [old locus tag: SACOL0550 ]
  • symbol: SACOL_RS02815
  • description: hypothetical protein
  • length: 87
  • theoretical pI: 10.3609
  • theoretical MW: 9856.36
  • GRAVY: -0.478161

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL0550
  • PFAM:
    S4 (CL0492) S4; S4 domain (PF01479; HMM-score: 37.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9987
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0011
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009238
    • TAT(Tat/SPI): 0.001471
    • LIPO(Sec/SPII): 0.001435
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVEDVLTIRFGQKLVTVKVTALNEHASKDNAKGMYEIIEERRLEEA

Experimental data[edit | edit source]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 1.138 1.139 1.140 1.141 1.142 1.143 1.144 1.145 1.146 1.147 1.148 1.149 1.150 1.151 1.152 1.153 1.154 1.155 1.156 1.157 1.158 1.159 1.160 1.161 1.162 1.163 1.164 1.165 1.166 1.167 1.168 1.169 1.170 1.171 1.172 1.173 1.174 1.175 1.176 1.177 1.178 1.179 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

This data comes from external databases and cannot be edited.

Other Information[edit | edit source]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]