Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS06405 [old locus tag: SACOL1254 ]
- pan locus tag?: SAUPAN003527000
- symbol: SACOL_RS06405
- pan gene symbol?: rpsP
- synonym:
- product: 30S ribosomal protein S16
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS06405 [old locus tag: SACOL1254 ]
- symbol: SACOL_RS06405
- product: 30S ribosomal protein S16
- replicon: chromosome
- strand: +
- coordinates: 1263501..1263776
- length: 276
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCAGTTAAAATTCGTTTAACACGTTTAGGTTCAAAAAGAAATCCATTCTATCGTATC
GTAGTAGCAGATGCTCGTTCTCCACGTGACGGACGTATCATCGAACAAATCGGTACTTAT
AACCCAACGAGCGCTAATGCTCCAGAAATTAAAGTTGACGAAGCGTTAGCTTTAAAATGG
TTAAATGATGGTGCGAAACCAACTGATACAGTTCACAATATCTTATCAAAAGAAGGTATT
ATGAAAAAATTTGACGAACAAAAGAAAGCTAAGTAA60
120
180
240
276
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS06405 [old locus tag: SACOL1254 ]
- symbol: SACOL_RS06405
- description: 30S ribosomal protein S16
- length: 91
- theoretical pI: 10.6208
- theoretical MW: 10234.8
- GRAVY: -0.608791
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS16 (TIGR00002; HMM-score: 111.3)
- TheSEED: see SACOL1254
- PFAM: no clan defined Ribosomal_S16; Ribosomal protein S16 (PF00886; HMM-score: 84.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009549
- TAT(Tat/SPI): 0.000637
- LIPO(Sec/SPII): 0.001934
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL1254
- protein localization: see SACOL1254
- quantitative data / protein copy number per cell: see SACOL1254
- interaction partners:
SACOL_RS01040 formate acetyltransferase [1] (data from MRSA252) SACOL_RS02330 IMP dehydrogenase [1] (data from MRSA252) SACOL_RS03035 50S ribosomal protein L10 [1] (data from MRSA252) SACOL_RS03080 elongation factor Tu [1] (data from MRSA252) SACOL_RS04310 aldehyde dehydrogenase [1] (data from MRSA252) SACOL_RS05630 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SACOL_RS11010 uracil phosphoribosyltransferase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)