From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS06595 [old locus tag: SACOL1292 ]
  • symbol: SACOL_RS06595
  • product: 30S ribosomal protein S15
  • replicon: chromosome
  • strand: +
  • coordinates: 1305226..1305495
  • length: 270
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1305226..1305495) NCBI
  • BioCyc: SACOL_RS06595 BioCyc
  • MicrobesOnline: see SACOL1292

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCAATTTCACAAGAACGTAAAAACGAAATCATTAAAGAATACCGTGTACACGAAACT
    GATACTGGTTCACCAGAAGTACAAATCGCTGTACTTACTGCAGAAATCAACGCAGTAAAC
    GAACACTTACGTACACACAAAAAAGACCACCATTCACGTCGTGGATTATTAAAAATGGTA
    GGTCGTCGTAGACATTTATTAAACTACTTACGTAGTAAAGATATTCAACGTTACCGTGAA
    TTAATTAAATCACTTGGTATCCGTCGTTAA
    60
    120
    180
    240
    270

Protein[edit | edit source]

Protein Data Bank: 5LI0

General[edit | edit source]

  • locus tag: SACOL_RS06595 [old locus tag: SACOL1292 ]
  • symbol: SACOL_RS06595
  • description: 30S ribosomal protein S15
  • length: 89
  • theoretical pI: 11.1219
  • theoretical MW: 10608.2
  • GRAVY: -0.895506

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS15 (TIGR00952; HMM-score: 135)
    and 1 more
    chorismatase, FkbO/Hyg5 family (TIGR04444; EC 4.1.3.-; HMM-score: 14.2)
  • TheSEED: see SACOL1292
  • PFAM:
    S15_NS1 (CL0600) Ribosomal_S15; Ribosomal protein S15 (PF00312; HMM-score: 129.7)
    and 1 more
    CDA (CL0109) YwqJ-deaminase; YwqJ-like deaminase (PF14431; HMM-score: 16.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8278
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.171
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004453
    • TAT(Tat/SPI): 0.000756
    • LIPO(Sec/SPII): 0.000507
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYLRSKDIQRYRELIKSLGIRR

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Jump up to: 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]