Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS03065 [old locus tag: SACOL0591 ]
- pan locus tag?: SAUPAN002317000
- symbol: SACOL_RS03065
- pan gene symbol?: rpsL
- synonym:
- product: 30S ribosomal protein S12
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS03065 [old locus tag: SACOL0591 ]
- symbol: SACOL_RS03065
- product: 30S ribosomal protein S12
- replicon: chromosome
- strand: +
- coordinates: 614788..615201
- length: 414
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCCAACTATTAACCAATTAGTACGTAAACCAAGACAAAGCAAAATCAAAAAATCAGAT
TCTCCAGCTTTAAATAAAGGTTTCAACAGTAAAAAGAAAAAATTTACTGACTTAAACTCA
CCACAAAAACGTGGTGTATGTACTCGTGTAGGTACAATGACACCTAGAAAACCTAACTCA
GCGTTACGTAAATATGCACGTGTGCGTTTATCAAACAACATCGAAATTAACGCATACATC
CCTGGTATCGGACATAACTTACAAGAACACAGTGTTGTACTTGTACGTGGTGGACGTGTA
AGAGACTTACCAGGTGTGCGTTACCATATTGTACGTGGAGCACTTGATACTTCAGGTGTT
GACGGACGTAGACAAGGTCGTTCATTATACGGAACTAAGAAACCTAAAAACTAA60
120
180
240
300
360
414
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS03065 [old locus tag: SACOL0591 ]
- symbol: SACOL_RS03065
- description: 30S ribosomal protein S12
- length: 137
- theoretical pI: 12.011
- theoretical MW: 15342.7
- GRAVY: -0.862774
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00981; HMM-score: 218.8)and 2 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00982; HMM-score: 39.2)Protein synthesis Translation factors translation initiation factor IF-1 (TIGR00008; HMM-score: 12.6)
- TheSEED: see SACOL0591
- PFAM: OB (CL0021) Ribosom_S12_S23; Ribosomal protein S12/S23 (PF00164; HMM-score: 115.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6654
- Cytoplasmic Membrane Score: 0.0546
- Cell wall & surface Score: 0.0015
- Extracellular Score: 0.2786
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.026283
- TAT(Tat/SPI): 0.013391
- LIPO(Sec/SPII): 0.00523
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVRDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL0591
- protein localization: see SACOL0591
- quantitative data / protein copy number per cell: see SACOL0591
- interaction partners:
SACOL_RS11135 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SACOL_RS00095 50S ribosomal protein L9 [1] (data from MRSA252) SACOL_RS00470 peptidoglycan-binding protein LysM [1] (data from MRSA252) SACOL_RS01530 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SACOL_RS02200 30S ribosomal protein S6 [1] (data from MRSA252) SACOL_RS02210 30S ribosomal protein S18 [1] (data from MRSA252) SACOL_RS02790 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) SACOL_RS02825 RNA-binding protein S1 [1] (data from MRSA252) SACOL_RS03025 50S ribosomal protein L11 [1] (data from MRSA252) SACOL_RS03035 50S ribosomal protein L10 [1] (data from MRSA252) SACOL_RS03040 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL_RS03070 30S ribosomal protein S7 [1] (data from MRSA252) SACOL_RS03755 LysR family transcriptional regulator [1] (data from MRSA252) SACOL_RS03810 hypothetical protein [1] (data from MRSA252) SACOL_RS04290 ATP-dependent Clp protease proteolytic subunit [1] (data from MRSA252) SACOL_RS04320 triose-phosphate isomerase [1] (data from MRSA252) SACOL_RS04330 enolase [1] (data from MRSA252) SACOL_RS04950 glucose-6-phosphate isomerase [1] (data from MRSA252) SACOL_RS05135 oligoendopeptidase F [1] (data from MRSA252) SACOL_RS05205 hypothetical protein [1] (data from MRSA252) SACOL_RS05570 phosphocarrier protein HPr [1] (data from MRSA252) SACOL_RS05605 ribonuclease J 1 [1] (data from MRSA252) SACOL_RS06175 isoleucine--tRNA ligase [1] (data from MRSA252) SACOL_RS06330 50S ribosomal protein L28 [1] (data from MRSA252) SACOL_RS06375 acyl carrier protein [1] (data from MRSA252) SACOL_RS06405 30S ribosomal protein S16 [1] (data from MRSA252) SACOL_RS06420 50S ribosomal protein L19 [1] (data from MRSA252) SACOL_RS06445 succinyl-CoA ligase subunit beta [1] (data from MRSA252) SACOL_RS06495 GTP-sensing pleiotropic transcriptional regulator CodY [1] (data from MRSA252) SACOL_RS06595 30S ribosomal protein S15 [1] (data from MRSA252) SACOL_RS06605 ribonuclease J 2 [1] (data from MRSA252) SACOL_RS06770 glutamine synthetase [1] (data from MRSA252) SACOL_RS06965 catalase [1] (data from MRSA252) SACOL_RS07390 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SACOL_RS07720 30S ribosomal protein S1 [1] (data from MRSA252) SACOL_RS07830 rRNA pseudouridine synthase [1] (data from MRSA252) SACOL_RS08115 glycine dehydrogenase [1] (data from MRSA252) SACOL_RS08345 molecular chaperone DnaK [1] (data from MRSA252) SACOL_RS08375 30S ribosomal protein S20 [1] (data from MRSA252) SACOL_RS08420 RNA-binding protein [1] (data from MRSA252) SACOL_RS08520 hypothetical protein [1] (data from MRSA252) SACOL_RS08615 bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase [1] (data from MRSA252) SACOL_RS08670 50S ribosomal protein L27 [1] (data from MRSA252) SACOL_RS08680 50S ribosomal protein L21 [1] (data from MRSA252) SACOL_RS08820 50S ribosomal protein L20 [1] (data from MRSA252) SACOL_RS08830 translation initiation factor IF-3 [1] (data from MRSA252) SACOL_RS08970 universal stress protein [1] (data from MRSA252) SACOL_RS09000 acetate kinase [1] (data from MRSA252) SACOL_RS09010 2-Cys peroxiredoxin [1] (data from MRSA252) SACOL_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) SACOL_RS10360 manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) SACOL_RS10530 molecular chaperone GroEL [1] (data from MRSA252) SACOL_RS11150 purine-nucleoside phosphorylase [1] (data from MRSA252) SACOL_RS11155 DNA starvation/stationary phase protection protein [1] (data from MRSA252) SACOL_RS11230 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SACOL_RS11435 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SACOL_RS11615 30S ribosomal protein S9 [1] (data from MRSA252) SACOL_RS11655 30S ribosomal protein S11 [1] (data from MRSA252) SACOL_RS11660 30S ribosomal protein S13 [1] (data from MRSA252) SACOL_RS11685 50S ribosomal protein L15 [1] (data from MRSA252) SACOL_RS11695 30S ribosomal protein S5 [1] (data from MRSA252) SACOL_RS11705 50S ribosomal protein L6 [1] (data from MRSA252) SACOL_RS11730 50S ribosomal protein L14 [1] (data from MRSA252) SACOL_RS11735 30S ribosomal protein S17 [1] (data from MRSA252) SACOL_RS11740 50S ribosomal protein L29 [1] (data from MRSA252) SACOL_RS11745 50S ribosomal protein L16 [1] (data from MRSA252) SACOL_RS11750 30S ribosomal protein S3 [1] (data from MRSA252) SACOL_RS11755 50S ribosomal protein L22 [1] (data from MRSA252) SACOL_RS11760 30S ribosomal protein S19 [1] (data from MRSA252) SACOL_RS11765 50S ribosomal protein L2 [1] (data from MRSA252) SACOL_RS11770 50S ribosomal protein L23 [1] (data from MRSA252) SACOL_RS11775 50S ribosomal protein L4 [1] (data from MRSA252) SACOL_RS11780 50S ribosomal protein L3 [1] (data from MRSA252) SACOL_RS11785 30S ribosomal protein S10 [1] (data from MRSA252) SACOL_RS13725 malate:quinone oxidoreductase [1] (data from MRSA252) SACOL_RS13915 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)