Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS04490 [old locus tag: SACOL0875 ]
- pan locus tag?: SAUPAN002819000
- symbol: SACOL_RS04490
- pan gene symbol?: —
- synonym:
- product: thiol reductase thioredoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS04490 [old locus tag: SACOL0875 ]
- symbol: SACOL_RS04490
- product: thiol reductase thioredoxin
- replicon: chromosome
- strand: -
- coordinates: 896714..897034
- length: 321
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCAATCAATCAAAAGTAATGAATCATTTAAATCTGTAATTAATAGCGATACACCTGTA
ATTGTTAAATTTGAGGCAGGATGGTGCCCAGACTGTCGTGCTATGGATTTATGGATTGAC
CCAATCGTAGAACAATATAATGATTACCAATGGTATACTGTTAATCGTGATGAATTAGAA
GATGTAGTTGTTGAAAATGAAGTTATGGGTATCCCTAGCTTGCTAGTATTTAAAAACGGC
GATAAAATTGCACACCTTCATTCAGCAAATGCTAAGTCACCTGAACAAGTTGAATCATTT
TTAGCAGAAACTTTTAAATAA60
120
180
240
300
321
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS04490 [old locus tag: SACOL0875 ]
- symbol: SACOL_RS04490
- description: thiol reductase thioredoxin
- length: 106
- theoretical pI: 4.22853
- theoretical MW: 12140.6
- GRAVY: -0.314151
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 56.4)and 3 moreProtein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 34)protein disulfide isomerase (TIGR01130; HMM-score: 24.9)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 13.8)
- TheSEED: see SACOL0875
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 62.1)and 7 moreThioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 20.1)Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 18.3)Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 16.4)Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 15)Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 14.5)HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 13.3)TXD17-like_Trx; Thioredoxin domain-containing protein 17-like, thioredoxin domain (PF06110; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9871
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0
- Extracellular Score: 0.0125
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007747
- TAT(Tat/SPI): 0.000221
- LIPO(Sec/SPII): 0.001056
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]