Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1091 [new locus tag: SACOL_RS05570 ]
- pan locus tag?: SAUPAN003303000
- symbol: ptsH
- pan gene symbol?: ptsH
- synonym:
- product: phosphocarrier protein HPr
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1091 [new locus tag: SACOL_RS05570 ]
- symbol: ptsH
- product: phosphocarrier protein HPr
- replicon: chromosome
- strand: +
- coordinates: 1101785..1102051
- length: 267
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237816 NCBI
- RefSeq: YP_185955 NCBI
- BioCyc: see SACOL_RS05570
- MicrobesOnline: 912559 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAACAAAATTCATATGTAATCATCGACGAGACTGGTATTCACGCTAGACCAGCAACA
ATGTTAGTACAAACAGCTTCAAAATTCGATTCTGATATTCAATTAGAATATAACGGTAAG
AAAGTAAACTTAAAATCAATCATGGGTGTTATGAGCCTTGGTGTTGGTAAAGATGCTGAA
ATTACAATTTATGCTGACGGTAGTGATGAATCTGACGCCATTCAAGCAATCAGTGATGTC
TTATCAAAAGAAGGATTGACTAAATAA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1091 [new locus tag: SACOL_RS05570 ]
- symbol: PtsH
- description: phosphocarrier protein HPr
- length: 88
- theoretical pI: 4.26765
- theoretical MW: 9495.67
- GRAVY: -0.181818
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00474
- TAT(Tat/SPI): 0.000465
- LIPO(Sec/SPII): 0.001045
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAEITIYADGSDESDAIQAISDVLSKEGLTK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 2448 [5]
- interaction partners:
SACOL0452 (ahpC) alkyl hydroperoxide reductase subunit C [6] (data from MRSA252) SACOL1478 (ald1) alanine dehydrogenase [6] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [6] (data from MRSA252) SACOL2656 (arcB2) ornithine carbamoyltransferase [6] (data from MRSA252) SACOL0557 (cysK) cysteine synthase [6] (data from MRSA252) SACOL0123 (deoC1) deoxyribose-phosphate aldolase [6] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [6] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [6] (data from MRSA252) SACOL0634 (eutD) phosphotransacetylase [6] (data from MRSA252) SACOL1329 (femC) glutamine synthetase [6] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [6] (data from MRSA252) SACOL1199 (ftsZ) cell division protein FtsZ [6] (data from MRSA252) SACOL0593 (fusA) elongation factor G [6] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [6] (data from MRSA252) SACOL2145 (glmS) glucosamine--fructose-6-phosphate aminotransferase [6] (data from MRSA252) SACOL2016 (groEL) chaperonin GroEL [6] (data from MRSA252) SACOL0461 (guaA) GMP synthase [6] (data from MRSA252) SACOL0460 (guaB) inosine-5'-monophosphate dehydrogenase [6] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [6] (data from MRSA252) SACOL1477 (ilvA1) threonine dehydratase [6] (data from MRSA252) SACOL0222 (ldh1) L-lactate dehydrogenase [6] (data from MRSA252) SACOL2618 (ldh2) L-lactate dehydrogenase [6] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [6] (data from MRSA252) SACOL0746 (norR) MarR family transcriptional regulator [6] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [6] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [6] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [6] (data from MRSA252) SACOL0966 (pgi) glucose-6-phosphate isomerase [6] (data from MRSA252) SACOL0839 (pgk) phosphoglycerate kinase [6] (data from MRSA252) SACOL0841 (pgm) phosphoglyceromutase [6] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [6] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [6] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [6] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [6] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [6] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [6] (data from MRSA252) SACOL2212 (rplQ) 50S ribosomal protein L17 [6] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [6] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [6] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [6] (data from MRSA252) SACOL0545 (rplY) 50S ribosomal protein L25/general stress protein Ctc [6] (data from MRSA252) SACOL0589 (rpoC) DNA-directed RNA polymerase subunit beta' [6] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [6] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [6] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [6] (data from MRSA252) SACOL2225 (rpsH) 30S ribosomal protein S8 [6] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [6] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [6] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [6] (data from MRSA252) SACOL1292 (rpsO) 30S ribosomal protein S15 [6] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [6] (data from MRSA252) SACOL1610 (sodA2) superoxide dismutase [6] (data from MRSA252) SACOL0095 (spa) immunoglobulin G binding protein A precursor [6] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [6] (data from MRSA252) SACOL1263 (sucD) succinyl-CoA synthetase subunit alpha [6] (data from MRSA252) SACOL1729 (thrS) threonyl-tRNA synthetase [6] (data from MRSA252) SACOL1722 (tig) trigger factor [6] (data from MRSA252) SACOL1276 (tsf) elongation factor Ts [6] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [6] (data from MRSA252) SACOL2104 (upp) uracil phosphoribosyltransferase [6] (data from MRSA252) SACOL0521 hypothetical protein [6] (data from MRSA252) SACOL0564 pyridoxal biosynthesis lyase PdxS [6] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [6] (data from MRSA252) SACOL0742 hypothetical protein [6] (data from MRSA252) SACOL0944 NADH dehydrogenase [6] (data from MRSA252) SACOL1759 universal stress protein [6] (data from MRSA252) SACOL1801 dipeptidase PepV [6] (data from MRSA252) SACOL1952 ferritins family protein [6] (data from MRSA252) SACOL1992 hypothetical protein [6] (data from MRSA252) SACOL2173 alkaline shock protein 23 [6] (data from MRSA252) SACOL2561 hydroxymethylglutaryl-CoA synthase [6] (data from MRSA252) SACOL2569 1-pyrroline-5-carboxylate dehydrogenase [6] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.00 6.01 6.02 6.03 6.04 6.05 6.06 6.07 6.08 6.09 6.10 6.11 6.12 6.13 6.14 6.15 6.16 6.17 6.18 6.19 6.20 6.21 6.22 6.23 6.24 6.25 6.26 6.27 6.28 6.29 6.30 6.31 6.32 6.33 6.34 6.35 6.36 6.37 6.38 6.39 6.40 6.41 6.42 6.43 6.44 6.45 6.46 6.47 6.48 6.49 6.50 6.51 6.52 6.53 6.54 6.55 6.56 6.57 6.58 6.59 6.60 6.61 6.62 6.63 6.64 6.65 6.66 6.67 6.68 6.69 6.70 6.71 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)