Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001047
- pan locus tag?: SAUPAN003303000
- symbol: JSNZ_001047
- pan gene symbol?: ptsH
- synonym:
- product: phosphocarrier protein HPr
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001047
- symbol: JSNZ_001047
- product: phosphocarrier protein HPr
- replicon: chromosome
- strand: +
- coordinates: 1052212..1052478
- length: 267
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAACAAAATTCATATGTAATCATCGACGAGACTGGTATTCACGCTAGACCAGCAACA
ATGTTAGTACAAACAGCTTCAAAATTCGATTCTGATATTCAATTAGAATATAACGGTAAG
AAAGTAAACTTAAAATCAATCATGGGTGTTATGAGCCTTGGTGTTGGTAAAGATGCTGAA
ATTACAATTTATGCTGACGGTAGTGATGAATCTGACGCCATTCAAGCAATCAGTGACGTC
TTATCAAAAGAAGGATTGACTAAATAA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001047
- symbol: JSNZ_001047
- description: phosphocarrier protein HPr
- length: 88
- theoretical pI: 4.26765
- theoretical MW: 9495.67
- GRAVY: -0.181818
⊟Function[edit | edit source]
- TIGRFAM: Signal transduction PTS phosphocarrier, HPr family (TIGR01003; HMM-score: 113.9)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined PTS-HPr; PTS HPr component phosphorylation site (PF00381; HMM-score: 108.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9993
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00474
- TAT(Tat/SPI): 0.000465
- LIPO(Sec/SPII): 0.001045
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAEITIYADGSDESDAIQAISDVLSKEGLTK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.