Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0003 [new locus tag: SACOL_RS00035 ]
- pan locus tag?: SAUPAN000009000
- symbol: SACOL0003
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0003 [new locus tag: SACOL_RS00035 ]
- symbol: SACOL0003
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 3697..3942
- length: 246
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236184 NCBI
- RefSeq: YP_184914 NCBI
- BioCyc: see SACOL_RS00035
- MicrobesOnline: 911485 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTA
AAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAA
GTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGT
ATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAA
CAATGA60
120
180
240
246
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0003 [new locus tag: SACOL_RS00035 ]
- symbol: SACOL0003
- description: hypothetical protein
- length: 81
- theoretical pI: 4.35578
- theoretical MW: 9137.35
- GRAVY: -0.197531
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair S4 domain protein YaaA (TIGR02988; HMM-score: 90)
- TheSEED :
- FIG002958: hypothetical protein
- PFAM: S4 (CL0492) S4_2; S4 domain (PF13275; HMM-score: 72.4)and 1 moreSYY_C-terminal; Tyrosine--tRNA ligase SYY-like C-terminal domain (PF22421; HMM-score: 23.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9994
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0
- Extracellular Score: 0.0004
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002067
- TAT(Tat/SPI): 0.000157
- LIPO(Sec/SPII): 0.000268
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 3920 [4]
- interaction partners:
SACOL1760 (ackA) acetate kinase [5] (data from MRSA252) SACOL0660 (adhP) alcohol dehydrogenase [5] (data from MRSA252) SACOL2218 (adk) adenylate kinase [5] (data from MRSA252) SACOL0452 (ahpC) alkyl hydroperoxide reductase subunit C [5] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [5] (data from MRSA252) SACOL2656 (arcB2) ornithine carbamoyltransferase [5] (data from MRSA252) SACOL1685 (aspS) aspartyl-tRNA synthetase [5] (data from MRSA252) SACOL0570 (clpC) [5] (data from MRSA252) SACOL2074 (ddl) D-alanyl-alanine synthetase A [5] (data from MRSA252) SACOL0123 (deoC1) deoxyribose-phosphate aldolase [5] (data from MRSA252) SACOL2130 (deoD) purine nucleoside phosphorylase [5] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [5] (data from MRSA252) SACOL1587 (efp) elongation factor P [5] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [5] (data from MRSA252) SACOL0634 (eutD) phosphotransacetylase [5] (data from MRSA252) SACOL1245 (fabG1) 3-oxoacyl-ACP reductase [5] (data from MRSA252) SACOL2091 (fabZ) (3R)-hydroxymyristoyl-ACP dehydratase [5] (data from MRSA252) SACOL2117 (fbaA) fructose-bisphosphate aldolase [5] (data from MRSA252) SACOL2622 (fdaB) fructose-1,6-bisphosphate aldolase [5] (data from MRSA252) SACOL1410 (femA) femA protein [5] (data from MRSA252) SACOL1329 (femC) glutamine synthetase [5] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [5] (data from MRSA252) SACOL1072 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [5] (data from MRSA252) SACOL0593 (fusA) elongation factor G [5] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [5] (data from MRSA252) SACOL1960 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [5] (data from MRSA252) SACOL2145 (glmS) glucosamine--fructose-6-phosphate aminotransferase [5] (data from MRSA252) SACOL1742 (gltA) citrate synthase [5] (data from MRSA252) SACOL0574 (gltX) glutamyl-tRNA synthetase [5] (data from MRSA252) SACOL0961 (gluD) glutamate dehydrogenase [5] (data from MRSA252) SACOL1622 (glyS) glycyl-tRNA synthetase [5] (data from MRSA252) SACOL1554 (gnd) 6-phosphogluconate dehydrogenase [5] (data from MRSA252) SACOL2415 (gpmA) phosphoglyceromutase [5] (data from MRSA252) SACOL2016 (groEL) chaperonin GroEL [5] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [5] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [5] (data from MRSA252) SACOL1206 (ileS) isoleucyl-tRNA synthetase [5] (data from MRSA252) SACOL0240 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [5] (data from MRSA252) SACOL1368 (kataA) catalase [5] (data from MRSA252) SACOL2618 (ldh2) L-lactate dehydrogenase [5] (data from MRSA252) SACOL0562 (lysS) lysyl-tRNA synthetase [5] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [5] (data from MRSA252) SACOL0746 (norR) MarR family transcriptional regulator [5] (data from MRSA252) SACOL0793 (nrdF) ribonucleotide-diphosphate reductase subunit beta [5] (data from MRSA252) SACOL0582 (nusG) transcription antitermination protein [5] (data from MRSA252) SACOL1838 (pckA) phosphoenolpyruvate carboxykinase [5] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [5] (data from MRSA252) SACOL1005 (pepF) oligoendopeptidase F [5] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [5] (data from MRSA252) SACOL0966 (pgi) glucose-6-phosphate isomerase [5] (data from MRSA252) SACOL0839 (pgk) phosphoglycerate kinase [5] (data from MRSA252) SACOL0841 (pgm) phosphoglyceromutase [5] (data from MRSA252) SACOL1091 (ptsH) phosphocarrier protein HPr [5] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [5] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [5] (data from MRSA252) SACOL0583 (rplK) 50S ribosomal protein L11 [5] (data from MRSA252) SACOL2213 (rpoA) DNA-directed RNA polymerase subunit alpha [5] (data from MRSA252) SACOL0588 (rpoB) DNA-directed RNA polymerase subunit beta [5] (data from MRSA252) SACOL1516 (rpsA) 30S ribosomal protein S1 [5] (data from MRSA252) SACOL2225 (rpsH) 30S ribosomal protein S8 [5] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [5] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [5] (data from MRSA252) SACOL0591 (rpsL) 30S ribosomal protein S12 [5] (data from MRSA252) SACOL1610 (sodA2) superoxide dismutase [5] (data from MRSA252) SACOL0095 (spa) immunoglobulin G binding protein A precursor [5] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [5] (data from MRSA252) SACOL1831 (tal) translaldolase [5] (data from MRSA252) SACOL0840 (tpiA) triosephosphate isomerase [5] (data from MRSA252) SACOL1762 (tpx) thiol peroxidase [5] (data from MRSA252) SACOL1155 (trxA) thioredoxin [5] (data from MRSA252) SACOL1276 (tsf) elongation factor Ts [5] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [5] (data from MRSA252) SACOL2104 (upp) uracil phosphoribosyltransferase [5] (data from MRSA252) SACOL0426 acetyl-CoA acetyltransferase [5] (data from MRSA252) SACOL0521 hypothetical protein [5] (data from MRSA252) SACOL0707 dihydroxyacetone kinase subunit DhaK [5] (data from MRSA252) SACOL0721 hypothetical protein [5] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [5] (data from MRSA252) SACOL0742 hypothetical protein [5] (data from MRSA252) SACOL0876 hypothetical protein [5] (data from MRSA252) SACOL1020 hypothetical protein [5] (data from MRSA252) SACOL1099 hypothetical protein [5] (data from MRSA252) SACOL1437 CSD family cold shock protein [5] (data from MRSA252) SACOL1593 glycine dehydrogenase subunit 2 [5] (data from MRSA252) SACOL1801 dipeptidase PepV [5] (data from MRSA252) SACOL1946 methionine aminopeptidase [5] (data from MRSA252) SACOL2131 Dps family protein [5] (data from MRSA252) SACOL2173 alkaline shock protein 23 [5] (data from MRSA252) SACOL2296 glycerate dehydrogenase [5] (data from MRSA252) SACOL2535 D-lactate dehydrogenase [5] (data from MRSA252) SACOL2561 hydroxymethylglutaryl-CoA synthase [5] (data from MRSA252) SACOL2569 1-pyrroline-5-carboxylate dehydrogenase [5] (data from MRSA252) SACOL2609 hypothetical protein [5] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SACOL0003 > recF > gyrB > gyrA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 5.00 5.01 5.02 5.03 5.04 5.05 5.06 5.07 5.08 5.09 5.10 5.11 5.12 5.13 5.14 5.15 5.16 5.17 5.18 5.19 5.20 5.21 5.22 5.23 5.24 5.25 5.26 5.27 5.28 5.29 5.30 5.31 5.32 5.33 5.34 5.35 5.36 5.37 5.38 5.39 5.40 5.41 5.42 5.43 5.44 5.45 5.46 5.47 5.48 5.49 5.50 5.51 5.52 5.53 5.54 5.55 5.56 5.57 5.58 5.59 5.60 5.61 5.62 5.63 5.64 5.65 5.66 5.67 5.68 5.69 5.70 5.71 5.72 5.73 5.74 5.75 5.76 5.77 5.78 5.79 5.80 5.81 5.82 5.83 5.84 5.85 5.86 5.87 5.88 5.89 5.90 5.91 5.92 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)