From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2131 [new locus tag: SACOL_RS11155 ]
  • pan locus tag?: SAUPAN005436000
  • symbol: SACOL2131
  • pan gene symbol?: dps
  • synonym:
  • product: Dps family protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2131 [new locus tag: SACOL_RS11155 ]
  • symbol: SACOL2131
  • product: Dps family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2192272..2192715
  • length: 444
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTAATCAACAAGATGTTGTAAAAGAATTGAATCAACAAGTAGCAAACTGGACAGTA
    GCTTACACAAAGCTACACAATTTCCACTGGTATGTGAAAGGGCCTAACTTCTTCTCATTA
    CACGTTAAATTTGAAGAATTATATAATGAAGCAAGCCAATATGTAGACGAATTAGCTGAA
    AGAATTTTAGCGGTAGGAGGAAACCCTGTAGGTACATTAACTGAATGCTTAGAGCAATCA
    ATTGTTAAAGAAGCTGCGAAAGGTTACTCTGCAGAACAAATGGTTGAAGAATTATCACAA
    GACTTCACAAATATCTCAAAACAATTAGAAAACGCAATCGAAATTGCTGGTAATGCTGGC
    GATGATGTATCAGAAGATATGTTTATAGGTATGCAAACATCAGTAGATAAACATAATTGG
    ATGTTTAAATCTTACTTAAGCTAA
    60
    120
    180
    240
    300
    360
    420
    444


⊟Protein[edit | edit source]

Protein Data Bank: 2D5K

⊟General[edit | edit source]

  • locus tag: SACOL2131 [new locus tag: SACOL_RS11155 ]
  • symbol: SACOL2131
  • description: Dps family protein
  • length: 147
  • theoretical pI: 4.29468
  • theoretical MW: 16691.5
  • GRAVY: -0.394558

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds bacterioferritin (TIGR00754; HMM-score: 17.9)
  • TheSEED  :
    • DNA protection during starvation protein
    Stress Response Oxidative stress Oxidative stress  Ferroxidase (EC 1.16.3.1)
    and 2 more
    Stress Response Oxidative stress Oxidative stress  Iron-binding ferritin-like antioxidant protein
    Stress Response Oxidative stress Oxidative stress  Non-specific DNA-binding protein Dps
  • PFAM:
    Ferritin (CL0044) Ferritin; Ferritin-like domain (PF00210; HMM-score: 113.2)
    and 9 more
    no clan defined DUF5856; Family of unknown function (DUF5856) (PF19174; HMM-score: 28.5)
    E-set (CL0159) Lipase_bact_N; Bacterial virulence factor lipase N-terminal (PF12262; HMM-score: 16)
    no clan defined AvrM-A; Flax-rust effector AvrM-A (PF18241; HMM-score: 15)
    DUF4455; Domain of unknown function (DUF4455) (PF14643; HMM-score: 13.3)
    BST2; Bone marrow stromal antigen 2 (PF16716; HMM-score: 13.3)
    TPR (CL0020) ARMC9_ARM; LisH domain-containing protein ARMC9, ARM repeats (PF21050; HMM-score: 12.7)
    no clan defined Rab5-bind; Rabaptin-like protein (PF09311; HMM-score: 12.3)
    GP68; Gp68-like predicted RNA polymerase component (PF17469; HMM-score: 12.1)
    ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 11.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8161
    • Cytoplasmic Membrane Score: 0.0039
    • Cell wall & surface Score: 0.0017
    • Extracellular Score: 0.1783
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004322
    • TAT(Tat/SPI): 0.000179
    • LIPO(Sec/SPII): 0.000538
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAERILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAGDDVSEDMFIGMQTSVDKHNWMFKSYLS

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 4726 [5]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: PerR* (repression) regulon
    PerR*(TF)important in Oxidative stress response; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 154.41 h [6]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]