Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1946 [new locus tag: SACOL_RS10175 ]
- pan locus tag?: SAUPAN004903000
- symbol: SACOL1946
- pan gene symbol?: map
- synonym:
- product: methionine aminopeptidase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1946 [new locus tag: SACOL_RS10175 ]
- symbol: SACOL1946
- product: methionine aminopeptidase
- replicon: chromosome
- strand: -
- coordinates: 2007919..2008677
- length: 759
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237517 NCBI
- RefSeq: YP_186771 NCBI
- BioCyc: see SACOL_RS10175
- MicrobesOnline: 913425 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGATTGTAAAAACAGAAGAAGAATTACAAGCGTTAAAAGAAATTGGATACATATGCGCT
AAAGTGCGCAATACAATGCAAGCTGCAACCAAACCAGGTATCACTACGAAAGAGCTTGAT
AATATTGCGAAAGAGTTATTTGAAGAATACGGTGCTATTTCTGCGCCAATTCATGATGAA
AATTTTCCTGGTCAAACGTGTATTAGTGTCAATGAAGAGGTGGCACATGGGATTCCAAGT
AAGCGTGTCATTCGTGAAGGAGATTTAGTAAATATTGATGTATCGGCTTTGAAGAATGGC
TATTATGCAGATACAGGCATTTCATTTGTCGTTGGAGAATCAGATGATCCAATGAAACAA
AAAGTATGTGACGTAGCAACGATGGCATTTGAGAATGCAATTGCAAAAGTAAAACCGGGT
ACTAAGTTAAGTAACATTGGTAAAGCGGTGCATAATACAGCTAGACAAAATGATTTGAAA
GTCATTAAAAACTTAACAGGTCATGGTGTTGGTTTATCATTACATGAAGCACCAGCACAT
GTACTTAATTACTTTGATCCAAAAGACAAAACATTATTAACTGAAGGTATGGTATTAGCT
ATTGAACCGTTTATCTCATCAAATGCATCATTTGTTACAGAAGGTAAAAATGAATGGGCT
TTTGAAACGAGCGATAAAAGTTTTGTTGCTCAAATTGAGCATACGGTTATCGTGACTAAG
GATGGTCCGATTTTAACGACAAAGATTGAAGAAGAATAG60
120
180
240
300
360
420
480
540
600
660
720
759
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1946 [new locus tag: SACOL_RS10175 ]
- symbol: SACOL1946
- description: methionine aminopeptidase
- length: 252
- theoretical pI: 4.93689
- theoretical MW: 27502.1
- GRAVY: -0.215476
⊟Function[edit | edit source]
- reaction: EC 3.4.11.18? ExPASyMethionyl aminopeptidase Release of N-terminal amino acids, preferentially methionine, from peptides and arylamides
- TIGRFAM: Protein fate Protein modification and repair methionine aminopeptidase, type I (TIGR00500; EC 3.4.11.18; HMM-score: 282.6)and 3 moreProtein fate Protein modification and repair methionine aminopeptidase, type II (TIGR00501; EC 3.4.11.18; HMM-score: 110.5)Unknown function General DNA-binding protein, 42 kDa (TIGR00495; HMM-score: 53.2)ectoine utilization protein EutD (TIGR02993; EC 3.-.-.-; HMM-score: 11.5)
- TheSEED :
- Methionine aminopeptidase (EC 3.4.11.18)
Protein Metabolism Protein biosynthesis Translation termination factors bacterial Methionine aminopeptidase (EC 3.4.11.18)and 1 more - PFAM: no clan defined Peptidase_M24; Metallopeptidase family M24 (PF00557; HMM-score: 168.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Co2+, Fe2+, Mn2+, Zn2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9739
- Cytoplasmic Membrane Score: 0.0067
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.0187
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011197
- TAT(Tat/SPI): 0.001706
- LIPO(Sec/SPII): 0.00293
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 381 [5]
- interaction partners:
SACOL1637 (dnaK) molecular chaperone DnaK [6] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [6] (data from MRSA252) SACOL0593 (fusA) elongation factor G [6] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [6] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [6] (data from MRSA252) SACOL1103 (pdhB) pyruvate dehydrogenase complex E1 component subunit beta [6] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [6] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [6] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [6] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [6] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [6] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [6] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [6] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [6] (data from MRSA252) SACOL1449 (sucA) 2-oxoglutarate dehydrogenase E1 component [6] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [6] (data from MRSA252) SACOL1759 universal stress protein [6] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 45.17 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.00 6.01 6.02 6.03 6.04 6.05 6.06 6.07 6.08 6.09 6.10 6.11 6.12 6.13 6.14 6.15 6.16 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)