From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS12265 [old locus tag: NWMN_2120 ]
  • pan locus tag?: SAUPAN005667000
  • symbol: NWMN_RS12265
  • pan gene symbol?: rplM
  • synonym:
  • product: 50S ribosomal protein L13

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS12265 [old locus tag: NWMN_2120 ]
  • symbol: NWMN_RS12265
  • product: 50S ribosomal protein L13
  • replicon: chromosome
  • strand: -
  • coordinates: 2357468..2357905
  • length: 438
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2357468..2357905) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_2120

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCGTCAAACATTTATGGCAAATGAATCAAACATTGAGCGCAAATGGTATGTTATCGAT
    GCTGAAGGCCAAACATTAGGTCGTTTATCATCAGAAGTAGCATCTATCTTACGCGGTAAA
    AATAAAGTAACTTACACACCACACGTTGATACTGGTGATTATGTAATCGTTATTAATGCA
    TCAAAAATCGAATTTACTGGTAACAAAGAAACTGACAAAGTTTACTACCGTCACTCAAAT
    CACCCAGGTGGTATCAAATCAATCACTGCTGGTGAATTAAGAAGAACTAACCCAGAACGT
    TTAATTGAAAACTCAATTAAAGGTATGTTACCAAGCACTCGTTTAGGCGAAAAACAAGGT
    AAAAAATTATTTGTATATGGTGGCGCTGAACATCCACACGCTGCACAACAACCAGAAAAC
    TACGAATTACGTGGTTAA
    60
    120
    180
    240
    300
    360
    420
    438

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: NWMN_RS12265 [old locus tag: NWMN_2120 ]
  • symbol: NWMN_RS12265
  • description: 50S ribosomal protein L13
  • length: 145
  • theoretical pI: 9.74811
  • theoretical MW: 16333.3
  • GRAVY: -0.762069

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL13 (TIGR01066; HMM-score: 201.9)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL13 (TIGR01077; HMM-score: 49.1)
  • TheSEED: see NWMN_2120
  • PFAM:
    no clan defined Ribosomal_L13; Ribosomal protein L13 (PF00572; HMM-score: 153.8)
    and 1 more
    Trefoil (CL0066) Beta-tre_PLH30; Endo-acting ulvan lyase beta-trefoil domain (PF24208; HMM-score: 14.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.3965
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.6034
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009239
    • TAT(Tat/SPI): 0.000698
    • LIPO(Sec/SPII): 0.001378
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELRG

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]