Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS12350 [old locus tag: NWMN_2137 ]
- pan locus tag?: SAUPAN005687000
- symbol: NWMN_RS12350
- pan gene symbol?: rplF
- synonym:
- product: 50S ribosomal protein L6
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS12350 [old locus tag: NWMN_2137 ]
- symbol: NWMN_RS12350
- product: 50S ribosomal protein L6
- replicon: chromosome
- strand: -
- coordinates: 2368233..2368769
- length: 537
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAGTCGTGTTGGTAAGAAAATTATTGACATCCCTAGTGACGTAACAGTAACTTTTGAT
GGAAATCATGTAACTGTTAAAGGTCCTAAAGGTGAATTATCAAGAACTTTAAATGAAAGA
ATGACATTCAAACAAGAAGAAAACACAATTGAAGTTGTAAGACCATCTGATTCTAAAGAA
GATAGAACAAACCATGGTACAACTCGTGCTTTATTAAACAATATGGTACAAGGTGTTTCT
CAAGGATACGTAAAAGTACTTGAACTTGTTGGTGTAGGTTACCGTGCTCAAATGCAAGGT
AAAGACTTAATCCTTAACGTTGGTTATTCTCACCCAGTAGAAATTAAAGCTGAAGAAAAC
ATTACTTTCTCAGTTGAGAAAAACACAGTCGTTAAAGTTGAAGGTATTTCAAAAGAACAA
GTTGGAGCATTAGCATCTAACATCCGTTCAGTAAGACCTCCAGAGCCTTACAAAGGTAAA
GGTATTCGTTACCAAGGTGAATACGTTCGCCGTAAAGAAGGTAAAACTGGTAAATAA60
120
180
240
300
360
420
480
537
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: NWMN_RS12350 [old locus tag: NWMN_2137 ]
- symbol: NWMN_RS12350
- description: 50S ribosomal protein L6
- length: 178
- theoretical pI: 10.1171
- theoretical MW: 19786.4
- GRAVY: -0.635955
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL6 (TIGR03654; HMM-score: 247.2)and 2 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL6 (TIGR03653; HMM-score: 79.7)Planctomycetes uncharacterized domain TIGR03000 (TIGR03000; HMM-score: 13.3)
- TheSEED: see NWMN_2137
- PFAM: no clan defined Ribosomal_L6; Ribosomal protein L6 (PF00347; HMM-score: 151.1)and 1 moreE-set (CL0159) CO4A-B_CUB_C; Complement C4A/B CUB C-terminal domain (PF22661; HMM-score: 8.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.2113
- Cytoplasmic Membrane Score: 0.0037
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.7847
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008363
- TAT(Tat/SPI): 0.000401
- LIPO(Sec/SPII): 0.000857
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSRVGKKIIDIPSDVTVTFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEENITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRRKEGKTGK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_RS00885 formate acetyltransferase [1] (data from MRSA252) NWMN_RS02150 IMP dehydrogenase [1] (data from MRSA252) NWMN_RS02505 YbaB/EbfC family nucleoid-associated protein [1] (data from MRSA252) NWMN_RS02655 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) NWMN_RS02700 hypoxanthine-guanine phosphoribosyltransferase [1] (data from MRSA252) NWMN_RS02910 50S ribosomal protein L11 [1] (data from MRSA252) NWMN_RS02920 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_RS02950 30S ribosomal protein S12 [1] (data from MRSA252) NWMN_RS02960 elongation factor G [1] (data from MRSA252) NWMN_RS03590 hypothetical protein [1] (data from MRSA252) NWMN_RS03640 LysR family transcriptional regulator [1] (data from MRSA252) NWMN_RS03715 MarR family transcriptional regulator [1] (data from MRSA252) NWMN_RS04075 ribosomal subunit interface protein [1] (data from MRSA252) NWMN_RS04195 aldehyde dehydrogenase [1] (data from MRSA252) NWMN_RS04215 enolase [1] (data from MRSA252) NWMN_RS04675 NAD-specific glutamate dehydrogenase [1] (data from MRSA252) NWMN_RS04700 glucose-6-phosphate isomerase [1] (data from MRSA252) NWMN_RS04955 hypothetical protein [1] (data from MRSA252) NWMN_RS05320 phosphocarrier protein HPr [1] (data from MRSA252) NWMN_RS06435 beta-ketoacyl-ACP reductase [1] (data from MRSA252) NWMN_RS06840 glutamine synthetase [1] (data from MRSA252) NWMN_RS07605 serine/threonine dehydratase [1] (data from MRSA252) NWMN_RS07800 30S ribosomal protein S1 [1] (data from MRSA252) NWMN_RS07820 cytidylate kinase [1] (data from MRSA252) NWMN_RS08000 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [1] (data from MRSA252) NWMN_RS08350 molecular chaperone DnaK [1] (data from MRSA252) NWMN_RS08525 hypothetical protein [1] (data from MRSA252) NWMN_RS09195 thiol reductase thioredoxin [1] (data from MRSA252) NWMN_RS09230 dipeptidase PepV [1] (data from MRSA252) NWMN_RS09840 glucosamine-6-phosphate isomerase [1] (data from MRSA252) NWMN_RS11655 uracil phosphoribosyltransferase [1] (data from MRSA252) NWMN_RS11695 50S ribosomal protein L31 type B [1] (data from MRSA252) NWMN_RS11875 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) NWMN_RS12080 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) NWMN_RS12290 50S ribosomal protein L17 [1] (data from MRSA252) NWMN_RS12365 50S ribosomal protein L5 [1] (data from MRSA252) NWMN_RS12395 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_RS12410 50S ribosomal protein L2 [1] (data from MRSA252) NWMN_RS12415 50S ribosomal protein L23 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)