From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09195 [old locus tag: NWMN_1637 ]
  • pan locus tag?: SAUPAN004411000
  • symbol: NWMN_RS09195
  • pan gene symbol?: —
  • synonym:
  • product: thiol reductase thioredoxin

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS09195 [old locus tag: NWMN_1637 ]
  • symbol: NWMN_RS09195
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 1825386..1825697
  • length: 312
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (1825386..1825697) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1637

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAACAACTTGAATCAGAACAACAATTTGAATCTTTAAAACAAGGTGCTACAGTATTT
    GAATTCACTGCAGGCTGGTGTCCAGATTGTAGAGTGATAGAACCAGATTTACCGGAATTA
    GAAGCGAGATATCCTATGTTTGACTTCGTATCAGTAGACCGTGATAAATTTATGGATATT
    TGTATTGAAAATGGTATTATGGGTATTCCAAGTTTTCTAGTATATAAAAATGGAGAACTG
    CTTGGAAGTTATATTGGAAAAGAACGAAAATCAATTGAACAGATAGATGCATTTTTAGCT
    CAATACGTGTAA
    60
    120
    180
    240
    300
    312


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_RS09195 [old locus tag: NWMN_1637 ]
  • symbol: NWMN_RS09195
  • description: thiol reductase thioredoxin
  • length: 103
  • theoretical pI: 4.14259
  • theoretical MW: 11855.5
  • GRAVY: -0.168932

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 47.6)
    and 6 more
    protein disulfide isomerase (TIGR01130; HMM-score: 26.4)
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 24.9)
    Genetic information processing Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 19.2)
    glutaredoxin-like protein (TIGR02200; HMM-score: 16.2)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 14.6)
    Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 13.1)
  • TheSEED: see NWMN_1637
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 59.3)
    and 6 more
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 25.3)
    Phosducin; Phosducin (PF02114; HMM-score: 16.2)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 15.2)
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 14.9)
    HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 12.9)
    DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 12.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9735
    • Cytoplasmic Membrane Score: 0.0007
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.0251
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013564
    • TAT(Tat/SPI): 0.002238
    • LIPO(Sec/SPII): 0.007556
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDICIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    NWMN_RS04215enolase  [1] (data from MRSA252)
    NWMN_RS07785DNA-binding protein HU  [1] (data from MRSA252)
    NWMN_RS08350molecular chaperone DnaK  [1] (data from MRSA252)
    NWMN_RS0868550S ribosomal protein L21  [1] (data from MRSA252)
    NWMN_RS08930pyruvate kinase  [1] (data from MRSA252)
    NWMN_RS12080Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    NWMN_RS1241050S ribosomal protein L2  [1] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]