Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01860
- pan locus tag?: SAUPAN004411000
- symbol: SAOUHSC_01860
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01860
- symbol: SAOUHSC_01860
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1768586..1768897
- length: 312
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920538 NCBI
- RefSeq: YP_500364 NCBI
- BioCyc: G1I0R-1730 BioCyc
- MicrobesOnline: 1290278 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAACAACTTGAATCAGAACAACAATTTGAATCTTTAAAACAAGGTGCTACAGTATTT
GAATTCACTGCAGGCTGGTGTCCAGATTGTAGAGTGATAGAACCAGATTTACCGGAATTA
GAAGCGAGATATCCTATGTTTGACTTCGTATCAGTAGACCGTGATAAATTTATGGATATT
TGTATTGAAAATGGTATTATGGGTATTCCAAGTTTTCTAGTATATAAAAATGGAGAACTG
CTTGGAAGTTATATTGGAAAAGAACGAAAATCAATTGAACAGATAGATGCATTTTTAGCT
CAATACGTGTAA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01860
- symbol: SAOUHSC_01860
- description: hypothetical protein
- length: 103
- theoretical pI: 4.14259
- theoretical MW: 11855.5
- GRAVY: -0.168932
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 47.6)and 6 moreprotein disulfide isomerase (TIGR01130; HMM-score: 26.4)Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 24.9)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 19.2)glutaredoxin-like protein (TIGR02200; HMM-score: 16.2)glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 14.6)Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 13.1)
- TheSEED :
- Thioredoxin-like protein YtpP
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 58.1)and 6 moreThioredoxin_9; Thioredoxin (PF14595; HMM-score: 23.9)Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 17.6)Phosducin; Phosducin (PF02114; HMM-score: 16.2)Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 15.3)Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 12.5)DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013564
- TAT(Tat/SPI): 0.002238
- LIPO(Sec/SPII): 0.007556
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDICIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAOUHSC_01683 (dnaK) molecular chaperone DnaK [3] (data from MRSA252) SAOUHSC_00799 (eno) phosphopyruvate hydratase [3] (data from MRSA252) SAOUHSC_02509 (rplB) 50S ribosomal protein L2 [3] (data from MRSA252) SAOUHSC_01757 (rplU) 50S ribosomal protein L21 [3] (data from MRSA252) SAOUHSC_01490 DNA-binding protein HU [3] (data from MRSA252) SAOUHSC_01806 pyruvate kinase [3] (data from MRSA252) SAOUHSC_02441 alkaline shock protein 23 [3] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: murC < SAOUHSC_01857 < SAOUHSC_01858 < SAOUHSC_01859 < SAOUHSC_01860 < SAOUHSC_01861predicted SigA promoter [4] : SAOUHSC_01855 < murC < SAOUHSC_01857 < SAOUHSC_01858 < SAOUHSC_01859 < SAOUHSC_01860 < SAOUHSC_01861
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)