From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01855
  • pan locus tag?: SAUPAN004406000
  • symbol: SAOUHSC_01855
  • pan gene symbol?: facZ
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01855
  • symbol: SAOUHSC_01855
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1761257..1761748
  • length: 492
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGATTGGATTTTACCAATTGCTGGAATTATCGCTGCGATTGCATTCTTAATTTTATGT
    ATCGGTATCGTAGCTGTATTAAATTCTGTTAAGAAAAACTTAGATTATGTTGCAAAAACA
    CTTGACGGTGTAGAAGGTCAAGTTCAAGGTATTACTCGTGAAACAACAGATTTACTTCAT
    AAAGTAAACCGTTTAACTGAGGATATCCAAGGTAAAGTAGATCGTTTAAACTCAGTTGTA
    GATGCTGTTAAAGGTATCGGTGACTCAGTACAAACGTTAAACAGCTCTGTAGATCGTGTA
    ACAAATTCAATTACACATAATATTTCTCAAAATGAAGATAAAATCTCACAAGTTGTTCAA
    TGGTCAAATGTTGCAATGGAAATTGCAGACAAATGGCAAAATAGACACTACCGTCGTGGA
    AGTGCAAATTACAAAGCTAATAATGTAGCAACTGATGCAAATCATAGCTATACTTCTAGA
    GTAGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    492

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01855
  • symbol: SAOUHSC_01855
  • description: hypothetical protein
  • length: 163
  • theoretical pI: 7.67054
  • theoretical MW: 18002.2
  • GRAVY: -0.220245

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis virulence factor Mce family protein (TIGR00996; HMM-score: 33)
    and 7 more
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14.3)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14.3)
    helix-rich protein (TIGR04523; HMM-score: 14.1)
    Metabolism Transport and binding proteins Unknown substrate transport protein (TIGR00833; HMM-score: 13.5)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 13.5)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 13.5)
    two transmembrane protein (TIGR04527; HMM-score: 10.8)
  • TheSEED  :
    • UPF0478 protein YtxG
  • PFAM:
    no clan defined DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 98.9)
    and 42 more
    Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 23.1)
    Laminin_II; Laminin Domain II (PF06009; HMM-score: 21.3)
    Focal_AT; Focal adhesion targeting region (PF03623; HMM-score: 20.4)
    Reo_sigma (CL0326) Reo_sigmaC; Reovirus sigma C capsid protein (PF04582; HMM-score: 19.6)
    no clan defined HsbA; Hydrophobic surface binding protein A (PF12296; HMM-score: 19)
    IncA; IncA protein (PF04156; HMM-score: 17.7)
    Vps51 (CL0295) COG6; Conserved oligomeric complex COG6 (PF06419; HMM-score: 17.5)
    no clan defined Collagen_mid; Bacterial collagen, middle region (PF15984; HMM-score: 16.7)
    Sec34; Sec34-like family (PF04136; HMM-score: 16.5)
    Gp58; gp58-like protein (PF07902; HMM-score: 16.4)
    BORCS6; BLOC-1-related complex sub-unit 6 (PF10157; HMM-score: 16.2)
    STAND_N (CL0587) SesA; N-terminal domain on NACHT_NTPase and P-loop NTPases (PF17107; HMM-score: 16.2)
    no clan defined MCPsignal; Methyl-accepting chemotaxis protein (MCP) signalling domain (PF00015; HMM-score: 16.1)
    DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 15.8)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 15.7)
    BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 15.6)
    Tweety; Tweety (PF04906; HMM-score: 15.1)
    BORCS8; BLOC-1-related complex sub-unit 8 (PF10167; HMM-score: 15)
    NPV_P10; Nucleopolyhedrovirus P10 protein (PF05531; HMM-score: 14.7)
    MSP1b; Major surface protein 1B (PF03429; HMM-score: 14.2)
    UPF0184; Uncharacterised protein family (UPF0184) (PF03670; HMM-score: 14.2)
    DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 14.2)
    PDDEXK (CL0236) RmuC; RmuC family (PF02646; HMM-score: 14.1)
    Vps51 (CL0295) COG2; COG (conserved oligomeric Golgi) complex component, COG2 (PF06148; HMM-score: 14.1)
    no clan defined EzrA; Septation ring formation regulator, EzrA (PF06160; HMM-score: 14.1)
    AI-2E_transport; AI-2E family transporter (PF01594; HMM-score: 14)
    Fzo_mitofusin; fzo-like conserved region (PF04799; HMM-score: 13.9)
    Laminin_I; Laminin Domain I (PF06008; HMM-score: 13.8)
    SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 13.8)
    no clan defined BORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 13.8)
    DUF16; Protein of unknown function DUF16 (PF01519; HMM-score: 13.7)
    Vps51 (CL0295) COG5; Golgi transport complex subunit 5 (PF10392; HMM-score: 13.5)
    no clan defined ApoLp-III; Apolipophorin-III precursor (apoLp-III) (PF07464; HMM-score: 13.2)
    DUF4446; Protein of unknown function (DUF4446) (PF14584; HMM-score: 13.2)
    DivIVA; DivIVA protein (PF05103; HMM-score: 13)
    Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 12.6)
    Prominin; Prominin (PF05478; HMM-score: 12.4)
    Chlorosome_CsmC; Chlorosome envelope protein C (PF11098; HMM-score: 12)
    DASH_Dad2; DASH complex subunit Dad2 (PF08654; HMM-score: 11.4)
    GP41; Retroviral envelope protein (PF00517; HMM-score: 11.1)
    OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 9.8)
    no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 8.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.089509
    • TAT(Tat/SPI): 0.00082
    • LIPO(Sec/SPII): 0.071432
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDWILPIAGIIAAIAFLILCIGIVAVLNSVKKNLDYVAKTLDGVEGQVQGITRETTDLLHKVNRLTEDIQGKVDRLNSVVDAVKGIGDSVQTLNSSVDRVTNSITHNISQNEDKISQVVQWSNVAMEIADKWQNRHYRRGSANYKANNVATDANHSYTSRVDK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:
    SAOUHSC_01683(dnaK)molecular chaperone DnaK  [3] (data from MRSA252)
    SAOUHSC_00519(rplA)50S ribosomal protein L1  [3] (data from MRSA252)
    SAOUHSC_02512(rplC)50S ribosomal protein L3  [3] (data from MRSA252)
    SAOUHSC_01418(sucA)2-oxoglutarate dehydrogenase E1 component  [3] (data from MRSA252)
    SAOUHSC_01040pyruvate dehydrogenase complex, E1 component subunit alpha  [3] (data from MRSA252)
    SAOUHSC_01041pyruvate dehydrogenase complex, E1 component subunit beta  [3] (data from MRSA252)
    SAOUHSC_01042branched-chain alpha-keto acid dehydrogenase subunit E2  [3] (data from MRSA252)
    SAOUHSC_01806pyruvate kinase  [3] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [5] [4]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 3.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  4. ↑ 4.0 4.1 4.2 4.3 4.4 4.5 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  5. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_01855&oldid=87063"