From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01855
  • pan locus tag?: SAUPAN004406000
  • symbol: SAOUHSC_01855
  • pan gene symbol?: facZ
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01855
  • symbol: SAOUHSC_01855
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1761257..1761748
  • length: 492
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGATTGGATTTTACCAATTGCTGGAATTATCGCTGCGATTGCATTCTTAATTTTATGT
    ATCGGTATCGTAGCTGTATTAAATTCTGTTAAGAAAAACTTAGATTATGTTGCAAAAACA
    CTTGACGGTGTAGAAGGTCAAGTTCAAGGTATTACTCGTGAAACAACAGATTTACTTCAT
    AAAGTAAACCGTTTAACTGAGGATATCCAAGGTAAAGTAGATCGTTTAAACTCAGTTGTA
    GATGCTGTTAAAGGTATCGGTGACTCAGTACAAACGTTAAACAGCTCTGTAGATCGTGTA
    ACAAATTCAATTACACATAATATTTCTCAAAATGAAGATAAAATCTCACAAGTTGTTCAA
    TGGTCAAATGTTGCAATGGAAATTGCAGACAAATGGCAAAATAGACACTACCGTCGTGGA
    AGTGCAAATTACAAAGCTAATAATGTAGCAACTGATGCAAATCATAGCTATACTTCTAGA
    GTAGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    492


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01855
  • symbol: SAOUHSC_01855
  • description: hypothetical protein
  • length: 163
  • theoretical pI: 7.67054
  • theoretical MW: 18002.2
  • GRAVY: -0.220245

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis virulence factor Mce family protein (TIGR00996; HMM-score: 33)
    and 7 more
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14.3)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14.3)
    helix-rich protein (TIGR04523; HMM-score: 14.1)
    Metabolism Transport and binding proteins Unknown substrate transport protein (TIGR00833; HMM-score: 13.5)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 13.5)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 13.5)
    two transmembrane protein (TIGR04527; HMM-score: 10.8)
  • TheSEED  :
    • UPF0478 protein YtxG
  • PFAM:
    no clan defined DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 103.1)
    and 44 more
    TPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 26.9)
    no clan defined DUF7310; Coiled-coil region of unknown function (DUF7310) (PF23991; HMM-score: 26)
    Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 22.5)
    Concanavalin (CL0004) Laminin_II; Laminin Domain II (PF06009; HMM-score: 21.3)
    no clan defined Focal_AT; Focal adhesion targeting region (PF03623; HMM-score: 19.6)
    HsbA; Hydrophobic surface binding protein A (PF12296; HMM-score: 18.5)
    TPR (CL0020) Sec10_N; Exocyst complex component Sec10, N-terminal (PF20667; HMM-score: 17.9)
    NUDIX (CL0261) NUDIX_5; NUDIX, or N-terminal NPxY motif-rich, region of KRIT (PF16705; HMM-score: 17.7)
    no clan defined Gp58; gp58-like protein (PF07902; HMM-score: 16.8)
    Chlorosome_CsmC; Chlorosome envelope protein C (PF11098; HMM-score: 16.6)
    BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 16.3)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 16.1)
    Mce4_CUP1; Cholesterol uptake porter CUP1 of Mce4, putative (PF11887; HMM-score: 16.1)
    DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 16)
    MCPsignal; Methyl-accepting chemotaxis protein (MCP) signalling domain (PF00015; HMM-score: 15.9)
    BORCS6; BLOC-1-related complex sub-unit 6 C-terminal helix (PF10157; HMM-score: 15.8)
    NPV_P10; Nucleopolyhedrovirus P10 protein (PF05531; HMM-score: 15.7)
    TPR (CL0020) COG3_N; Conserved oligomeric Golgi complex subunit 3, N-terminal (PF04136; HMM-score: 15.6)
    no clan defined Tweety; Tweety (PF04906; HMM-score: 15.6)
    Ferritin (CL0044) DUF2383; Domain of unknown function (DUF2383) (PF09537; HMM-score: 15.6)
    STAND_N (CL0587) SesA; N-terminal domain on NACHT_NTPase and P-loop NTPases (PF17107; HMM-score: 15.4)
    no clan defined BORCS8; BLOC-1-related complex sub-unit 8 (PF10167; HMM-score: 14.6)
    DUF7217; Domain of unknown function (DUF7217) (PF23854; HMM-score: 14.6)
    Fzo_mitofusin; fzo-like conserved region (PF04799; HMM-score: 14.4)
    UPF0184; Uncharacterised protein family (UPF0184) (PF03670; HMM-score: 14.3)
    DUF16; Protein of unknown function DUF16 (PF01519; HMM-score: 14.2)
    Prominin; Prominin (PF05478; HMM-score: 14.1)
    Spectrin (CL0743) Spectrin_Anc-1; Nuclear anchorage protein 1, spectrin-like repeat (PF24611; HMM-score: 14)
    no clan defined Laminin_I; Laminin Domain I (PF06008; HMM-score: 13.9)
    PDDEXK (CL0236) RmuC; RmuC family (PF02646; HMM-score: 13.8)
    Apolipoprotein (CL0725) ApoLp-III; Apolipophorin-III precursor (apoLp-III) (PF07464; HMM-score: 13.8)
    no clan defined BORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 13.6)
    TPR (CL0020) COG4_N; Conserved oligomeric Golgi complex subunit 4, N-terminal (PF20663; HMM-score: 13.4)
    no clan defined AI-2E_transport; AI-2E family transporter (PF01594; HMM-score: 13.2)
    TPR (CL0020) COG5_N; Conserved oligomeric Golgi complex subunit 5, N-terminal (PF10392; HMM-score: 13.2)
    no clan defined DUF4446; Protein of unknown function (DUF4446) (PF14584; HMM-score: 12.9)
    TPR (CL0020) EXOC6_Sec15_N; Exocyst complex component EXOC6/Sec15, N-terminal (PF20651; HMM-score: 12.8)
    no clan defined DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 12.7)
    DUF6674; Family of unknown function (DUF6674) (PF20379; HMM-score: 12.7)
    DivIVA; DivIVA protein (PF05103; HMM-score: 12.4)
    Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 12.3)
    SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 12.1)
    E-set (CL0159) DUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 11.2)
    no clan defined GP41; Retroviral envelope protein (PF00517; HMM-score: 8.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0103
    • Cytoplasmic Membrane Score: 0.9886
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0009
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.089509
    • TAT(Tat/SPI): 0.00082
    • LIPO(Sec/SPII): 0.071432
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDWILPIAGIIAAIAFLILCIGIVAVLNSVKKNLDYVAKTLDGVEGQVQGITRETTDLLHKVNRLTEDIQGKVDRLNSVVDAVKGIGDSVQTLNSSVDRVTNSITHNISQNEDKISQVVQWSNVAMEIADKWQNRHYRRGSANYKANNVATDANHSYTSRVDK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:
    SAOUHSC_01683(dnaK)molecular chaperone DnaK  [3] (data from MRSA252)
    SAOUHSC_00519(rplA)50S ribosomal protein L1  [3] (data from MRSA252)
    SAOUHSC_02512(rplC)50S ribosomal protein L3  [3] (data from MRSA252)
    SAOUHSC_01418(sucA)2-oxoglutarate dehydrogenase E1 component  [3] (data from MRSA252)
    SAOUHSC_01040pyruvate dehydrogenase complex, E1 component subunit alpha  [3] (data from MRSA252)
    SAOUHSC_01041pyruvate dehydrogenase complex, E1 component subunit beta  [3] (data from MRSA252)
    SAOUHSC_01042branched-chain alpha-keto acid dehydrogenase subunit E2  [3] (data from MRSA252)
    SAOUHSC_01806pyruvate kinase  [3] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [5] [4]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 3.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  4. ↑ 4.0 4.1 4.2 4.3 4.4 4.5 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  5. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]